PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

WALNUT_00025719-RA

Organism

Juglans regia

Taxonomic ID

51240

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans

Family

WRKY

Protein Properties

Length: 121aa MW: 13818.6 Da PI: 10.0318

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
WALNUT_00025719-RA	genome	JHU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	98.1	5.5e-31	32	90	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDg++WrKYG+K+vk+s++pr+YY+C+s gC+vkk+ver++ed ++v++tYeg Hnhe WALNUT_00025719-RA 32 MDDGFKWRKYGKKSVKNSPNPRNYYKCSSGGCEVKKRVERDREDASYVITTYEGVHNHE 90 69********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.8E-33	19	92	IPR003657	WRKY domain
SuperFamily	SSF118290	8.37E-28	24	92	IPR003657	WRKY domain
PROSITE profile	PS50811	30.963	27	92	IPR003657	WRKY domain
SMART	SM00774	1.7E-34	32	91	IPR003657	WRKY domain
Pfam	PF03106	2.0E-24	33	90	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009867	Biological Process	jasmonic acid mediated signaling pathway
GO:0042742	Biological Process	defense response to bacterium
GO:0050832	Biological Process	defense response to fungus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 121 aa Download sequence Send to blast
MLKRCKNIGV KKSKMDAGHR VAFRTQSELE VMDDGFKWRK YGKKSVKNSP NPRNYYKCSS 60 GGCEVKKRVE RDREDASYVI TTYEGVHNHE SPCVVYYNQT PLMVPTGWTL QANSSRSSSS 120 S

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ayd_A	9e-27	20	92	2	74	WRKY transcription factor 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018810763.1	4e-84	PREDICTED: probable WRKY transcription factor 51 isoform X1
Swissprot	Q93WU9	7e-45	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	A0A2I4DUD6	9e-83	A0A2I4DUD6_JUGRE; probable WRKY transcription factor 51 isoform X1
STRING	XP_010261070.1	9e-67	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1120	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	6e-47	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]