![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00028034-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 66aa MW: 7502.45 Da PI: 10.0321 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 41.6 | 2.9e-13 | 18 | 62 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+g+W++eEde l ++v+ G ++W+ I + + g ++k+c++rw +
WALNUT_00028034-RA 18 KGPWSPEEDEMLRKLVQSQGARSWSVINKAIA-GWSGKSCRLRWGN 62
79******************************.***********65 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 18.117 | 13 | 66 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.7E-10 | 17 | 66 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.5E-18 | 17 | 66 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 1.2E-12 | 18 | 62 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 2.99E-14 | 18 | 66 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 4.72E-10 | 20 | 62 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MESRFHGYAS QRDVDPVKGP WSPEEDEMLR KLVQSQGARS WSVINKAIAG WSGKSCRLRW 60 GNQLSP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018806534.1 | 2e-35 | PREDICTED: myb protein-like | ||||
| Swissprot | O23160 | 2e-19 | MYB73_ARATH; Transcription factor MYB73 | ||||
| TrEMBL | A0A2I4DHB1 | 5e-34 | A0A2I4DHB1_JUGRE; myb protein-like | ||||
| STRING | XP_004305954.1 | 8e-22 | (Fragaria vesca) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5074 | 32 | 56 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G23290.1 | 2e-22 | myb domain protein 70 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




