![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00029061-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 84aa MW: 9634 Da PI: 4.4085 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 59.7 | 7.8e-19 | 17 | 72 | 2 | 57 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHH CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQL 57
Fl+kl +++++e+++++sws+++nsfvv+++ efa k+Lpk+Fkh+n+aSF+ L
WALNUT_00029061-RA 17 FLRKLDAMVDESETDSMVSWSDSNNSFVVWNPYEFAAKLLPKHFKHKNLASFTLTL 72
9***************************************************8766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 5.4E-20 | 9 | 74 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 7.8E-7 | 13 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 6.44E-18 | 14 | 76 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 6.7E-9 | 17 | 40 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 1.9E-15 | 17 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 6.7E-9 | 55 | 67 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MVDVNDAGSS MDTLPPFLRK LDAMVDESET DSMVSWSDSN NSFVVWNPYE FAAKLLPKHF 60 KHKNLASFTL TLVIFYLFCS DFFL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018829016.1 | 4e-33 | PREDICTED: heat stress transcription factor A-1b-like | ||||
| Refseq | XP_018829017.1 | 4e-33 | PREDICTED: heat stress transcription factor A-1b-like | ||||
| Swissprot | Q7XRX3 | 1e-18 | HFB2A_ORYSJ; Heat stress transcription factor B-2a | ||||
| TrEMBL | A0A2I4FBJ6 | 9e-32 | A0A2I4FBJ6_JUGRE; heat stress transcription factor A-1b-like | ||||
| STRING | Aquca_005_00532.1 | 3e-19 | (Aquilegia coerulea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02990.1 | 2e-20 | heat shock transcription factor A1E | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




