![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00029221-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 68aa MW: 7609.61 Da PI: 10.9457 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 36.4 | 1.2e-11 | 12 | 50 | 1 | 40 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
+g+W++eEde l ++v+ G ++W I++ + gR++k+c
WALNUT_00029221-RA 12 KGPWSPEEDEMLRKLVQGKGARSWYVISKAIA-GRSGKSC 50
79******************************.******9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.72E-11 | 6 | 50 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 12.837 | 7 | 68 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.5E-4 | 11 | 60 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-13 | 11 | 50 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 7.5E-11 | 12 | 50 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 7.97E-9 | 14 | 50 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MEASQRDVDR VKGPWSPEED EMLRKLVQGK GARSWYVISK AIAGRSGKSC GFVGATNFHR 60 RWSTGPSR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018827388.1 | 6e-25 | PREDICTED: transcription factor MYB44-like | ||||
| Swissprot | O23160 | 8e-15 | MYB73_ARATH; Transcription factor MYB73 | ||||
| TrEMBL | A0A2I4F6X7 | 1e-23 | A0A2I4F6X7_JUGRE; transcription factor MYB44-like | ||||
| STRING | EMJ00498 | 3e-17 | (Prunus persica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G23290.1 | 1e-17 | myb domain protein 70 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




