![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | WALNUT_00031892-RA | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 81aa MW: 9304.95 Da PI: 10.6628 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 90.4 | 9.5e-29 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien++nrqvt+skRr+g++KKA+EL vLCda+v++i++ss+ kl++y
WALNUT_00031892-RA 9 KRIENETNRQVTYSKRRKGLFKKAHELTVLCDAKVSLIMISSNKKLRDYV 58
79**********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 30.319 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 5.89E-30 | 1 | 70 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.7E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 4.78E-33 | 2 | 66 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.9E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.1E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.9E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.9E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MARGKIQIKR IENETNRQVT YSKRRKGLFK KAHELTVLCD AKVSLIMISS NKKLRDYVSP 60 STTYVISFFL ILCLSSSAYT N |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 6e-17 | 1 | 66 | 1 | 66 | MEF2C |
| 5f28_B | 6e-17 | 1 | 66 | 1 | 66 | MEF2C |
| 5f28_C | 6e-17 | 1 | 66 | 1 | 66 | MEF2C |
| 5f28_D | 6e-17 | 1 | 66 | 1 | 66 | MEF2C |
| 6byy_A | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6byy_B | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6byy_C | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6byy_D | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_A | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_B | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_C | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| 6bz1_D | 5e-17 | 1 | 66 | 1 | 66 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. | |||||
| UniProt | Transcription factor involved in the genetic control of flower development. Acts in conjunction with GLOBOSA (glo). | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AJ313089 | 1e-82 | AJ313089.1 Juglans regia partial mRNA for putative apetala 3 protein (ap3 gene). | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018859339.1 | 5e-53 | PREDICTED: floral homeotic protein AGAMOUS-like | ||||
| Swissprot | P23706 | 8e-32 | DEFA_ANTMA; Floral homeotic protein DEFICIENS | ||||
| Swissprot | P35632 | 9e-32 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
| TrEMBL | A0A2I4HT72 | 1e-51 | A0A2I4HT72_JUGRE; floral homeotic protein AGAMOUS-like | ||||
| STRING | Migut.N03130.1.p | 1e-30 | (Erythranthe guttata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2735 | 33 | 75 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54340.1 | 4e-34 | MIKC_MADS family protein | ||||




