PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_004489393.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9764.84 Da PI: 7.7578

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_004489393.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	101.8	4.7e-32	19	76	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++v+Y eC+kNhAa++Gg+avDGC+Efm+s geegt+ al CaACgCHRnFH+reve+e XP_004489393.1 19 RSVKYGECQKNHAANVGGYAVDGCREFMAS-GEEGTSVALICAACGCHRNFHKREVENE 76 5799***********************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	5.0E-22	1	71	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.3E-30	21	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.7E-26	22	73	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	25.626	23	72	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MRKRQVVVRR TSSCEDQQRS VKYGECQKNH AANVGGYAVD GCREFMASGE EGTSVALICA 60 ACGCHRNFHK REVENEVVSE CSSPHSNGT

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_004489393.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027187539.1	1e-59	mini zinc finger protein 2-like
Refseq	XP_027187540.1	1e-59	mini zinc finger protein 2-like
Swissprot	Q9LJW5	3e-37	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A1S3DY23	3e-58	A0A1S3DY23_CICAR; mini zinc finger protein 2-like
STRING	XP_004489393.1	4e-59	(Cicer arietinum)
STRING	XP_004489394.1	4e-59	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-31	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]