![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_004493959.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 78aa MW: 8603.33 Da PI: 11.0691 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 127.7 | 3.4e-40 | 14 | 78 | 6 | 70 |
S1FA 6 veakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ ++G+nPGlivllvvgglll+fl+gny+ly+yaqk++ PrkkkP+skkk+k+e+l+qGv++PGe
XP_004493959.1 14 AGSQGFNPGLIVLLVVGGLLLTFLIGNYVLYMYAQKTIAPRKKKPISKKKMKKERLRQGVSAPGE 78
5689************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 7.5E-39 | 15 | 78 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 8.0E-5 | 16 | 78 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MADKVPPSFD RKNAGSQGFN PGLIVLLVVG GLLLTFLIGN YVLYMYAQKT IAPRKKKPIS 60 KKKMKKERLR QGVSAPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_004493959.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT089697 | 5e-57 | BT089697.1 Soybean clone JCVI-FLGm-2J23 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004493959.1 | 8e-50 | DNA-binding protein S1FA-like | ||||
| Swissprot | Q42337 | 2e-15 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | A0A1S2XU08 | 2e-48 | A0A1S2XU08_CICAR; DNA-binding protein S1FA-like | ||||
| STRING | XP_004493959.1 | 3e-49 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37120.1 | 1e-07 | S1FA-like DNA-binding protein | ||||




