![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_004496024.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 154aa MW: 17243.3 Da PI: 6.7553 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 129 | 1.7e-40 | 6 | 88 | 4 | 86 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
++ lPianv+rimk+ lP nakisk++ke++qe v+efisfvt+eas+kcq+e+rk++ngdd++wal++lGf++y+e++ ++
XP_004496024.2 6 GEKTLPIANVGRIMKQNLPPNAKISKESKELMQESVTEFISFVTGEASEKCQKENRKSVNGDDICWALCSLGFDNYAEAIGKF 88
5789**************************************************************************99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.8E-38 | 5 | 87 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.71E-30 | 8 | 89 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.5E-24 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.9E-12 | 37 | 55 | No hit | No description |
| PRINTS | PR00615 | 1.9E-12 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 1.9E-12 | 75 | 93 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 154 aa Download sequence Send to blast |
MKSGDGEKTL PIANVGRIMK QNLPPNAKIS KESKELMQES VTEFISFVTG EASEKCQKEN 60 RKSVNGDDIC WALCSLGFDN YAEAIGKFGS EQAFNHYKNR YIVRDYYSLN EINFAKFNKV 120 ITLNSLSQNI AHSTNSICHV SSNLNSNDLD CSFP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 7e-35 | 1 | 90 | 1 | 88 | Transcription factor HapC (Eurofung) |
| 4g92_B | 7e-35 | 1 | 90 | 1 | 88 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_004496024.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC151426 | 2e-76 | AC151426.32 Medicago truncatula clone mth2-6o22, complete sequence. | |||
| GenBank | AC161241 | 2e-76 | AC161241.18 Medicago truncatula clone mth2-193c3, complete sequence. | |||
| GenBank | JQ918284 | 2e-76 | JQ918284.1 Medicago truncatula nuclear transcription factor Y subunit B11 (NF-YB11) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004496024.2 | 1e-112 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 2e-38 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A1S2XXF4 | 1e-110 | A0A1S2XXF4_CICAR; nuclear transcription factor Y subunit B-4 | ||||
| STRING | XP_004496024.1 | 1e-58 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 8e-41 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




