![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_004502538.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 119aa MW: 13532.3 Da PI: 9.9683 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 41.7 | 2.7e-13 | 4 | 38 | 12 | 47 |
HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++d+ +++G+g+Wk+I+r+m +Rt+ q+ s+ qky
XP_004502538.2 4 FIDGLNKYGKGDWKSISRHMR-TRTPTQVASHAQKY 38
9********************.*************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.341 | 1 | 43 | IPR017930 | Myb domain |
| CDD | cd00167 | 4.26E-10 | 3 | 39 | No hit | No description |
| SuperFamily | SSF46689 | 4.41E-11 | 4 | 44 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.3E-7 | 4 | 40 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.4E-10 | 4 | 41 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.4E-10 | 4 | 38 | IPR001005 | SANT/Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MVEFIDGLNK YGKGDWKSIS RHMRTRTPTQ VASHAQKYFN HLKSINENKK RRRRPSIHDV 60 THLENGNTSA HQLPVIGQTS NPTPGDMDYG FGSVHETVIP EALMNLGPMS YPMQHSYTL |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 48 | 53 | KKRRRR |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that coordinates abscisic acid (ABA) biosynthesis and signaling-related genes via binding to the specific promoter motif 5'-(A/T)AACCAT-3'. Represses ABA-mediated salt (e.g. NaCl and KCl) stress tolerance. Regulates leaf shape and promotes vegetative growth. {ECO:0000269|PubMed:26243618}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_004502538.2 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by salicylic acid (SA) and gibberellic acid (GA) (PubMed:16463103). Triggered by dehydration and salt stress (PubMed:26243618). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:26243618}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004502538.2 | 4e-86 | transcription factor SRM1-like | ||||
| Swissprot | Q9FNN6 | 3e-22 | SRM1_ARATH; Transcription factor SRM1 | ||||
| TrEMBL | A0A1S2YBV4 | 1e-84 | A0A1S2YBV4_CICAR; transcription factor SRM1-like | ||||
| STRING | XP_004502538.1 | 2e-85 | (Cicer arietinum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G23650.1 | 5e-25 | Homeodomain-like transcriptional regulator | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




