PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_004507593.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

NF-YB

Protein Properties

Length: 136aa MW: 15312.4 Da PI: 6.536

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_004507593.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	172.6	4.3e-54	21	114	4	97
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 q+r+lPianv+rimkk+lPa+akisk+aket+qecvsefisf+t+eas+kcq+ekrktingddl+wa++tlGfe+y+++lk+yl kyre+eg+k XP_004507593.1 21 QERLLPIANVGRIMKKALPAKAKISKEAKETMQECVSEFISFITGEASEKCQKEKRKTINGDDLVWAMTTLGFEEYADSLKIYLLKYREIEGDK 114 89******************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.1E-49	19	115	IPR009072	Histone-fold
SuperFamily	SSF47113	2.17E-38	21	115	IPR009072	Histone-fold
Pfam	PF00808	4.2E-28	24	88	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	3.2E-19	52	70	No hit	No description
PROSITE pattern	PS00685	0	55	71	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	3.2E-19	71	89	No hit	No description
PRINTS	PR00615	3.2E-19	90	108	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MGESDDESGG QGSSGYRESL QERLLPIANV GRIMKKALPA KAKISKEAKE TMQECVSEFI 60 SFITGEASEK CQKEKRKTIN GDDLVWAMTT LGFEEYADSL KIYLLKYREI EGDKNLSVAI 120 IGKEHQATTT HRFFQR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-46	21	109	4	92	Transcription factor HapC (Eurofung)
4g92_B	3e-46	21	109	4	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_004507593.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004507593.1	4e-97	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	1e-57	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
Swissprot	Q69J40	5e-57	NFYBA_ORYSJ; Nuclear transcription factor Y subunit B-10
TrEMBL	A0A1S2YNW2	9e-96	A0A1S2YNW2_CICAR; nuclear transcription factor Y subunit B-3-like
STRING	XP_004507593.1	1e-96	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	2e-56	nuclear factor Y, subunit B3

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Kim SK, et al. OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]