![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_004508609.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 146aa MW: 16733.7 Da PI: 5.0513 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 171.7 | 7.9e-54 | 21 | 116 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
+eqdr+lPianv+rimk++lP+nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal+tlGf+dy+ep++ yl +yrele++
XP_004508609.1 21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGTLGFDDYAEPMRRYLIRYRELEAD 115
89*******************************************************************************************99 PP
NF-YB 97 k 97
+
XP_004508609.1 116 R 116
7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.1E-51 | 16 | 135 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 9.63E-39 | 23 | 132 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.3E-27 | 26 | 90 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.3E-17 | 54 | 72 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 57 | 73 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.3E-17 | 73 | 91 | No hit | No description |
| PRINTS | PR00615 | 1.3E-17 | 92 | 110 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MMDNNNIGGS TSNNIENGSI KEQDRLLPIA NVGRIMKQIL PQNAKISKES KETMQECVSE 60 FISFVTSEAS EKCRKERRKT VNGDDICWAL GTLGFDDYAE PMRRYLIRYR ELEADRNTNN 120 INVQDRGNSP QENDHELFMF PPRGSN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-44 | 20 | 111 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-44 | 20 | 111 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_004508609.1 |
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC174371 | 1e-114 | AC174371.23 Medicago truncatula chromosome 8 clone mth2-50f21, complete sequence. | |||
| GenBank | BT137051 | 1e-114 | BT137051.1 Medicago truncatula clone JCVI-FLMt-1H17 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_004508609.1 | 1e-106 | nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O82248 | 2e-53 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A1S2YR61 | 1e-104 | A0A1S2YR61_CICAR; nuclear transcription factor Y subunit B-4-like | ||||
| STRING | XP_004508609.1 | 1e-105 | (Cicer arietinum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 4e-55 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




