![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009111054.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 163aa MW: 18620 Da PI: 10.9862 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 104.8 | 7.5e-33 | 26 | 82 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
++p+YVNaKQyq+Il+RRq+Rak+e ekkl +ksrkpylheSRh+hA+rRpRg+gGrF
XP_009111054.1 26 QDPVYVNAKQYQAILRRRQARAKAELEKKL-IKSRKPYLHESRHQHAIRRPRGNGGRF 82
68****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.5E-35 | 24 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.088 | 25 | 85 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 3.2E-28 | 28 | 82 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 1.8E-24 | 28 | 50 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 30 | 50 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 1.8E-24 | 59 | 82 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MSHEPTYVPY GGMPHSRMPL PPEMAQDPVY VNAKQYQAIL RRRQARAKAE LEKKLIKSRK 60 PYLHESRHQH AIRRPRGNGG RFAKKTNTKA AQQKAGEKRN ACRTQSPTSS SSDQPEAWND 120 ENRTQSKEMQ STACKRRKEA DCSGQQWNII SSNHPSQARL AIK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-19 | 26 | 82 | 2 | 58 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Bra.20611 | 5e-95 | bud| flower| leaf| root | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence, stems, flowers and siliques. {ECO:0000269|PubMed:11867211}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009111054.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BNU33884 | 1e-146 | U33884.1 Brassica napus clone bncbf-b1 CCAAT-binding factor B subunit homolog mRNA, complete cds. | |||
| GenBank | BNU33885 | 1e-146 | U33885.1 Brassica napus clone bncbf-b2 CCAAT-binding factor B subunit homolog mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018511878.1 | 1e-114 | PREDICTED: nuclear transcription factor Y subunit A-9-like | ||||
| Swissprot | Q945M9 | 9e-89 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
| TrEMBL | A0A078HG42 | 1e-113 | A0A078HG42_BRANA; BnaA01g25500D protein | ||||
| TrEMBL | M4E559 | 1e-113 | M4E559_BRARP; Uncharacterized protein | ||||
| STRING | Bra023913.1-P | 1e-114 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM13268 | 18 | 29 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G20910.1 | 1e-74 | nuclear factor Y, subunit A9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




