![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009118810.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9653.03 Da PI: 8.4984 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 29.2 | 2.2e-09 | 36 | 74 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
+T+eE++l+ + k+ G + W++Ia +++ gRt+ + +w
XP_009118810.1 36 MTQEEEDLICRMYKLVGER-WDLIAGRIP-GRTAQVIERFW 74
7******************.*********.****7776666 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 6.5E-6 | 32 | 80 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 6.52E-6 | 35 | 77 | No hit | No description |
| Pfam | PF00249 | 4.5E-8 | 36 | 74 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.34E-7 | 36 | 78 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-10 | 37 | 75 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MDKQRKSKHP KTNAYATIVS SSSEEVSSLE WEEIAMTQEE EDLICRMYKL VGERWDLIAG 60 RIPGRTAQVI ERFWVMKNHR RA |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing trichomes and non-root hair cells. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009118810.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY519518 | 3e-74 | AY519518.1 Arabidopsis thaliana MYB transcription factor (At1g01380) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009118810.1 | 2e-55 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Refseq | XP_013603708.1 | 2e-55 | PREDICTED: MYB-like transcription factor ETC1 | ||||
| Refseq | XP_013677149.1 | 2e-55 | MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 2e-34 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A078HK25 | 4e-54 | A0A078HK25_BRANA; BnaCnng08670D protein | ||||
| TrEMBL | A0A0D3DZE0 | 4e-54 | A0A0D3DZE0_BRAOL; Uncharacterized protein | ||||
| TrEMBL | A0A397Y6C7 | 4e-54 | A0A397Y6C7_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6GIS8 | 4e-54 | A0A3P6GIS8_BRAOL; Uncharacterized protein | ||||
| TrEMBL | M4EV02 | 4e-54 | M4EV02_BRARP; Uncharacterized protein | ||||
| STRING | Bra032635.1-P | 6e-55 | (Brassica rapa) | ||||
| STRING | Bo8g117860.1 | 6e-55 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 8e-36 | MYB_related family protein | ||||




