![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009119863.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 107aa MW: 13082.7 Da PI: 10.1453 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 27.9 | 5.4e-09 | 33 | 72 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+T++E++l+ + +++ G + W++Ia +++ gR ++++ +w
XP_009119863.1 33 MTEQEEDLIFRMHRLVGDR-WDLIAGRVP-GRQPEEIERYWI 72
7****************99.*********.***********5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00717 | 1.3E-6 | 29 | 77 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.36E-6 | 32 | 71 | No hit | No description |
| Pfam | PF00249 | 2.4E-8 | 33 | 72 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS50090 | 6.284 | 34 | 71 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 9.5E-11 | 34 | 72 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.17E-7 | 34 | 72 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010091 | Biological Process | trichome branching | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 107 aa Download sequence Send to blast |
MDNTDRRRRR KQHKVTLHDS EEVSSIEWEF INMTEQEEDL IFRMHRLVGD RWDLIAGRVP 60 GRQPEEIERY WIMRNSDGFA EKRRQLHHSS SHKSTKPHRP RFSIYPS |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Ubiquitous in young leaves. Later, restricted to the leaf base in the trichome initiation zone. In mature leaves, confined to trichome cells. {ECO:0000269|PubMed:12356720}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, leaves, siliques and inflorescences. {ECO:0000269|PubMed:12356720}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009119863.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF188211 | 1e-174 | KF188211.1 Brassica villosa BVTRY-1 (BVTRY-1) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009119863.1 | 4e-74 | PREDICTED: transcription factor TRY | ||||
| Swissprot | Q8GV05 | 8e-69 | TRY_ARATH; Transcription factor TRY | ||||
| TrEMBL | A0A397XS34 | 9e-73 | A0A397XS34_BRACM; Uncharacterized protein | ||||
| STRING | fgenesh1_pg.C_scaffold_8001350 | 2e-67 | (Arabidopsis lyrata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM323 | 28 | 194 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G53200.1 | 8e-62 | MYB_related family protein | ||||




