PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009128505.1

Organism

Brassica rapa

Taxonomic ID

3711

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB_related

Protein Properties

Length: 76aa MW: 8826.08 Da PI: 7.5253

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009128505.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	30.5	8.4e-10	32	71	3	44
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 ++ +eE++l + +k+ G + W++Ia +++ gRt+ ++ +w XP_009128505.1 32 NMNQEEEDLVCRMHKLVGDR-WELIAGRIP-GRTAQEIERFW 71 6789************99.*****.******999 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	6.1E-4	29	76	IPR001005	SANT/Myb domain
CDD	cd00167	6.85E-6	32	71	No hit	No description
Pfam	PF00249	2.4E-8	34	72	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.64E-7	34	72	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	3.8E-11	35	72	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009651	Biological Process	response to salt stress
GO:0009737	Biological Process	response to abscisic acid
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0010026	Biological Process	trichome differentiation
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0048765	Biological Process	root hair cell differentiation
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
MDKHLRTKQT KTSPIVASSA SQVSSIEWEA LNMNQEEEDL VCRMHKLVGD RWELIAGRIP 60 GRTAQEIERF WVMKNN

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in leaf epidermal cells, stomate guard cells in leaves, cotyledons and hypocotyls, inflorescences, developing seeds and siliques. {ECO:0000269\|PubMed:18305006}.

Functional Description ? help Back to Top
Source	Description
UniProt	MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, including endoreplication, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. May have pleiotropic effects on flowering development and epidermal cell size through the regulation of endoreduplication. {ECO:0000269\|PubMed:18305006}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_009128505.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB264292	7e-56	AB264292.1 Arabidopsis thaliana mRNA for CPL3, complete cds.
GenBank	AK118043	7e-56	AK118043.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL19-27-F14.
GenBank	AY519522	7e-56	AY519522.1 Arabidopsis thaliana MYB transcription factor (At4g01060) mRNA, complete cds.
GenBank	BT005611	7e-56	BT005611.1 Arabidopsis thaliana clone U50786 putative myb family transcription factor (At4g01060) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009128505.1	6e-51	PREDICTED: MYB-like transcription factor ETC3 isoform X2
Refseq	XP_013719389.1	6e-51	MYB-like transcription factor ETC3 isoform X2
Swissprot	Q9M157	4e-31	ETC3_ARATH; MYB-like transcription factor ETC3
TrEMBL	A0A3P6AVG3	1e-47	A0A3P6AVG3_BRACM; Uncharacterized protein
TrEMBL	M4CWE2	1e-47	M4CWE2_BRARP; Uncharacterized protein
STRING	Bra008539.1-P	2e-48	(Brassica rapa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G01060.2	5e-33	CAPRICE-like MYB3

Publications ? help Back to Top
Koiwa H, et al. C-terminal domain phosphatase-like family members (AtCPLs) differentially regulate Arabidopsis thaliana abiotic stress signaling, growth, and development. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(16): p. 10893-8 [PMID:12149434] Nemie-Feyissa D,Olafsdottir SM,Heidari B,Lillo C Nitrogen depletion and small R3-MYB transcription factors affecting anthocyanin accumulation in Arabidopsis leaves. Phytochemistry, 2014. 98: p. 34-40 [PMID:24388610] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Tominaga-Wada R,Wada T The ectopic localization of CAPRICE LIKE MYB3 protein in Arabidopsis root epidermis. J. Plant Physiol., 2016. 199: p. 111-115 [PMID:27302012] Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells. Plant J., 2016. 88(5): p. 762-774 [PMID:27496682] Tominaga-Wada R,Wada T Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation. Development, 2017. 144(13): p. 2375-2380 [PMID:28676568] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615]