![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009134914.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 179aa MW: 20329.9 Da PI: 4.9203 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 56.7 | 3e-18 | 11 | 57 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
++++ +qvtfskRr g++KKA EL +LC+aev +++fs+ +k y y
XP_009134914.1 11 VQDTNTKQVTFSKRRLGLFKKAGELATLCNAEVGIMVFSPGNKPYPY 57
6788899*********************************9998776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.4E-31 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.09E-25 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 25.175 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.98E-31 | 2 | 76 | No hit | No description |
| PRINTS | PR00404 | 1.4E-18 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.2E-20 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-18 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-18 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 179 aa Download sequence Send to blast |
MGRRKIKMEK VQDTNTKQVT FSKRRLGLFK KAGELATLCN AEVGIMVFSP GNKPYPYGSP 60 SFELVAERYN NESEDSDSCE TSGNGRGNRA RQEKRICKRL NSIMEQVEAE KKRGEDFEHQ 120 LETAGGEERF DKPIEELSLE ELEEYEGKMM DMLDNIQGNI SGMEVSSTLV IMSKDTQNK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6byy_B | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6byy_C | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6byy_D | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_A | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_B | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_C | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| 6bz1_D | 2e-17 | 1 | 78 | 1 | 78 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During embryogenesis, expressed in the chalazal endosperm. {ECO:0000269|PubMed:20631316}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269|PubMed:12949148}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009134914.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC189233 | 0.0 | AC189233.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB013O20, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009134914.1 | 1e-130 | PREDICTED: agamous-like MADS-box protein AGL29 | ||||
| Refseq | XP_013735893.1 | 1e-130 | agamous-like MADS-box protein AGL29 | ||||
| Swissprot | O64703 | 9e-58 | AGL29_ARATH; Agamous-like MADS-box protein AGL29 | ||||
| TrEMBL | A0A398A7D7 | 1e-128 | A0A398A7D7_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4CAI0 | 1e-128 | M4CAI0_BRARP; Uncharacterized protein | ||||
| STRING | Bra001209.1-P | 1e-129 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM86 | 28 | 390 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G66656.1 | 3e-76 | AGAMOUS-like 91 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




