![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009135363.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 118aa MW: 13266.4 Da PI: 8.8983 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 123.1 | 1.4e-38 | 5 | 104 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
+CaaCk+lrr+C+kdC+++pyfp ++p kf ++h+++Ga v+k+l++lp ++r +a++sl +eA++r++dPvyG+vg+i+ lq +++++++ la
XP_009135363.1 5 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFSCIHRIYGAGDVSKMLQQLPVQTRAEAVESLSFEAKCRVEDPVYGCVGIISLLQTHIQKTQTLLA 99
6********************************************************************************************99 PP
DUF260 96 llkee 100
++++e
XP_009135363.1 100 KTQAE 104
99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 23.414 | 4 | 105 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 5.6E-38 | 5 | 102 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 118 aa Download sequence Send to blast |
MNPKRCAACK YLRRRCPKDC IFSPYFPPSD PDKFSCIHRI YGAGDVSKML QQLPVQTRAE 60 AVESLSFEAK CRVEDPVYGC VGIISLLQTH IQKTQTLLAK TQAEIAVAQT KHSQHTNL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-36 | 6 | 105 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009135363.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AB473847 | 1e-106 | AB473847.1 Arabidopsis thaliana ASL14 mRNA for ASYMMETRIC LEAVES2-like 14 protein, complete cds. | |||
| GenBank | DQ056609 | 1e-106 | DQ056609.1 Arabidopsis thaliana putative LOB domain protein (At3g26620) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009135363.1 | 2e-84 | PREDICTED: LOB domain-containing protein 24-like | ||||
| Swissprot | P59468 | 3e-71 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | A0A291LR10 | 4e-81 | A0A291LR10_BRARR; Transcription factor LBD23 | ||||
| STRING | Bo3g065910.1 | 2e-79 | (Brassica oleracea) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM131 | 28 | 340 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 1e-73 | LOB domain-containing protein 24 | ||||




