| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | G2-like | 90.5 | 1.5e-28 | 234 | 287 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kpr++W+ eLH++Fv av+qL G ekA+Pk+ilelm+v+gLt+e+v+SHLQkYR+
XP_009135499.1 234 KPRVVWSVELHQQFVAAVNQL-GVEKAVPKKILELMNVPGLTRENVASHLQKYRI 287
79*******************.********************************7 PP
|
| 2 | Response_reg | 71.4 | 3.8e-24 | 33 | 141 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTT CS
Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaG 93
vl+vdD+p+ +++l+++l+ y ev+ + +e al ll++++ +D+++ D+ mp+mdG+ ll + e +lp+i+++a ++++ +l+ + G
XP_009135499.1 33 VLVVDDDPTCLMILERMLRTCLY-EVTKCNRAEMALSLLRKNKhgFDIVISDVHMPDMDGFVLLGHVGLEI-DLPVIMMSADDSKSVVLKGVTHG 125
89*********************.***************888889**********************6655.7********************** PP
ESEEEESS--HHHHHH CS
Response_reg 94 akdflsKpfdpeelvk 109
a d+l Kp+ +e+l +
XP_009135499.1 126 AVDYLIKPVRMEALKN 141
***********99986 PP
|
| Publications
? help Back to Top |
- Bürkle L,Meyer S,Dortay H,Lehrach H,Heyl A
In vitro recombination cloning of entire cDNA libraries in Arabidopsis thaliana and its application to the yeast two-hybrid system. Funct. Integr. Genomics, 2005. 5(3): p. 175-83 [PMID:15714319] - Moubayidin L, et al.
Spatial coordination between stem cell activity and cell differentiation in the root meristem. Dev. Cell, 2013. 26(4): p. 405-15 [PMID:23987513] - Takahashi N, et al.
Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] - Kurepa J,Li Y,Perry SE,Smalle JA
Ectopic expression of the phosphomimic mutant version of Arabidopsis response regulator 1 promotes a constitutive cytokinin response phenotype. BMC Plant Biol., 2014. 14: p. 28 [PMID:24423196] - Cortleven A, et al.
A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors. Plant Physiol., 2014. 164(3): p. 1470-83 [PMID:24424319] - Marín-de la Rosa N, et al.
Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] - D'Alessandro S,Golin S,Hardtke CS,Lo Schiavo F,Zottini M
The co-chaperone p23 controls root development through the modulation of auxin distribution in the Arabidopsis root meristem. J. Exp. Bot., 2015. 66(16): p. 5113-22 [PMID:26163704] - Jiang L, et al.
Strigolactones spatially influence lateral root development through the cytokinin signaling network. J. Exp. Bot., 2016. 67(1): p. 379-89 [PMID:26519957] - Moubayidin L, et al.
A SCARECROW-based regulatory circuit controls Arabidopsis thaliana meristem size from the root endodermis. Planta, 2016. 243(5): p. 1159-68 [PMID:26848984] - Muraro D, et al.
A multi-scale model of the interplay between cell signalling and hormone transport in specifying the root meristem of Arabidopsis thaliana. J. Theor. Biol., 2016. 404: p. 182-205 [PMID:27157127] - Cortleven A, et al.
Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes. Plant Physiol., 2016. 172(1): p. 464-78 [PMID:27388681] - Kobayashi K, et al.
Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] - Zhang TQ, et al.
A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] - Kushwah S,Laxmi A
The interaction between glucose and cytokinin signaling in controlling Arabidopsis thaliana seedling root growth and development. Plant Signal Behav, 2017. 12(5): p. e1312241 [PMID:28467152] - Meng WJ, et al.
Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] - Kobayashi K,Iwase A
Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal. Plant Signal Behav, 2017. 12(6): p. e1338999 [PMID:28594268] - Liu B,De Storme N,Geelen D
Cold interferes with male meiotic cytokinesis in Arabidopsis thaliana independently of the AHK2/3-AHP2/3/5 cytokinin signaling module. Cell Biol. Int., 2017. 41(8): p. 879-889 [PMID:28618065] - Zhang F,May A,Irish VF
Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] - Yan Z, et al.
Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1. Plant Physiol., 2017. 175(3): p. 1438-1454 [PMID:28931628] - Rong XF, et al.
Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] - Bustillo-Avendaño E, et al.
Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis. Plant Physiol., 2018. 176(2): p. 1709-1727 [PMID:29233938] - Waldie T,Leyser O
Cytokinin Targets Auxin Transport to Promote Shoot Branching. Plant Physiol., 2018. 177(2): p. 803-818 [PMID:29717021]
|