![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009137162.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 97aa MW: 11425.8 Da PI: 9.7942 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 118.4 | 2.7e-37 | 20 | 77 | 4 | 61 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
a+ cprCds+ntkfCyynnyslsqPry Ck+CrryWt+GG+lrn+P+Gg+ rk k+
XP_009137162.1 20 PARVCPRCDSDNTKFCYYNNYSLSQPRYSCKNCRRYWTHGGTLRNIPIGGSGRKTKRP 77
5789**************************************************9975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 4.0E-24 | 19 | 76 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 7.0E-33 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 27.876 | 22 | 76 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 24 | 60 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 97 aa Download sequence Send to blast |
MDKLNVFVRG DNQVNEEKPP ARVCPRCDSD NTKFCYYNNY SLSQPRYSCK NCRRYWTHGG 60 TLRNIPIGGS GRKTKRPKID QPSAENQQFE VFHQWRP |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009137162.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC172878 | 1e-146 | AC172878.1 Brassica rapa subsp. oleifera cultivar Inbred line 'Chiifu' clone KBrH069E01, complete sequence. | |||
| GenBank | AC241020 | 1e-146 | AC241020.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB039B11, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_013741408.1 | 2e-60 | dof zinc finger protein DOF4.4-like | ||||
| Swissprot | Q9SUA9 | 3e-41 | DOF44_ARATH; Dof zinc finger protein DOF4.4 | ||||
| TrEMBL | A0A078J093 | 4e-59 | A0A078J093_BRANA; BnaA03g58570D protein | ||||
| STRING | Bra038789.1-P | 7e-60 | (Brassica rapa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G21050.1 | 1e-43 | Dof-type zinc finger domain-containing protein | ||||




