![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009142500.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 155aa MW: 17552.6 Da PI: 6.7176 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 161.1 | 1.6e-50 | 45 | 140 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
+eqdr+ Pianv+ imk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa+a+lGf+dy+e+lk+y ++yr +ege
XP_009142500.1 45 KEQDRLPPIANVGGIMKNMLPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAEQLKKYSNRYRVIEGE 139
89*******************************************************************************************99 PP
NF-YB 97 k 97
k
XP_009142500.1 140 K 140
7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.4E-48 | 38 | 151 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.06E-36 | 47 | 150 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.8E-25 | 52 | 114 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 2.3E-19 | 78 | 96 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 81 | 97 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 2.3E-19 | 97 | 115 | No hit | No description |
| PRINTS | PR00615 | 2.3E-19 | 116 | 134 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 155 aa Download sequence Send to blast |
MAGNYPSFQN PIPRFQNYNF ASTSSHHHQH HDGLVVEQEE NMVIKEQDRL PPIANVGGIM 60 KNMLPPNAKI SKEAKETMQE CVSEFISFVT GEASDKCHKE KRKTVNGDDI CWAMANLGFD 120 DYAEQLKKYS NRYRVIEGEK SNHHGKGEAK SSPDN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 6e-42 | 44 | 134 | 1 | 91 | Transcription factor HapC (Eurofung) |
| 4g92_B | 6e-42 | 44 | 134 | 1 | 91 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_009142500.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC787665 | 0.0 | KC787665.1 Brassica napus transcription factor subunit NF-YB5 (NF-YB5) gene, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009142500.1 | 1e-115 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 2e-94 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | M4CJP4 | 1e-114 | M4CJP4_BRARP; Uncharacterized protein | ||||
| STRING | Bra004428.1-P | 1e-114 | (Brassica rapa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM255 | 28 | 229 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-96 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




