![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009601043.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 119aa MW: 13657.6 Da PI: 8.7464 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 68.8 | 1.1e-21 | 65 | 113 | 1 | 49 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49
+C++e+C +dls ak+y++rhkvC+vh+kap vlv+gl+qrf qqC r
XP_009601043.1 65 RCKMEKCGVDLSGAKKYYKRHKVCQVHAKAPIVLVAGLRQRFFQQCNRL 113
6*********************************************996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 1.3E-21 | 58 | 113 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 17.349 | 63 | 119 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.79E-20 | 64 | 113 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 5.0E-16 | 66 | 113 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 119 aa Download sequence Send to blast |
MATHIYGMPL KNTAENNDFD EEEETEEEEE ENVGVELIEE SNLKRKRLNL EKRKGSNSKG 60 GGGPRCKMEK CGVDLSGAKK YYKRHKVCQV HAKAPIVLVA GLRQRFFQQC NRLFPSRRC |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 2e-14 | 58 | 113 | 2 | 58 | squamosa promoter binding protein-like 4 |
| 1wj0_A | 7e-15 | 61 | 113 | 1 | 53 | squamosa promoter-binding protein-like 12 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016441586.1 | 1e-83 | PREDICTED: squamosa promoter-binding protein 2-like | ||||
| Swissprot | Q38740 | 2e-19 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
| TrEMBL | A0A1S3XNS5 | 3e-82 | A0A1S3XNS5_TOBAC; squamosa promoter-binding protein 2-like | ||||
| STRING | XP_009601043.1 | 4e-83 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA24035 | 2 | 2 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G42200.1 | 3e-18 | squamosa promoter binding protein-like 9 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




