![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009601142.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 85aa MW: 9480.32 Da PI: 10.2543 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 129.8 | 7.3e-41 | 18 | 85 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
++ ve++G+nPGl+vl+vvgglll flvgny+ly+yaqk+lPP+kkkPvskkklkre+lkqGv++PGe
XP_009601142.1 18 TKDVEVQGFNPGLMVLIVVGGLLLAFLVGNYLLYMYAQKTLPPKKKKPVSKKKLKRERLKQGVSAPGE 85
5679***************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD019013 | 0.008 | 18 | 85 | No hit | No description |
| Pfam | PF04689 | 2.5E-39 | 21 | 85 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 85 aa Download sequence Send to blast |
MDYEGDPPPS FDPMKNMTKD VEVQGFNPGL MVLIVVGGLL LAFLVGNYLL YMYAQKTLPP 60 KKKKPVSKKK LKRERLKQGV SAPGE |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009601142.1 | 2e-54 | PREDICTED: DNA-binding protein S1FA-like | ||||
| Refseq | XP_016442060.1 | 2e-54 | PREDICTED: DNA-binding protein S1FA-like | ||||
| Swissprot | P42553 | 2e-14 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A1S3XQC2 | 4e-53 | A0A1S3XQC2_TOBAC; DNA-binding protein S1FA-like | ||||
| STRING | XP_009601142.1 | 7e-54 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3174 | 22 | 49 |




