| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 83 | 1.9e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k ien+ rqvtfskRr+g++KKA+EL +LCdaev v++fs+tgkly ++s
XP_009612621.1 9 KMIENTNSRQVTFSKRRQGLMKKAKELAILCDAEVGVLVFSNTGKLYQFAS 59
68***********************************************86 PP
|
| 2 | K-box | 64.4 | 4.3e-22 | 85 | 173 | 12 | 100 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
a + ++q e++ L++e+ L++ q +l+G++Le L++k+LqqLe+qL +++ +++kK+++ll +ie++ +ek+++ en+aLr+++ee
XP_009612621.1 85 AAEHESQPEVNELRAEVALLRQVQSRLMGKELEGLNFKDLQQLEHQLSEGILAVKDKKEQVLLGKIEKSLLQEKKVSLENEALREQIEE 173
34556899******************************************************************************997 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| SMART | SM00432 | 1.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.455 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 9.21E-41 | 2 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 1.31E-32 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.1E-26 | 11 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 7.1E-16 | 86 | 171 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.266 | 87 | 177 | IPR002487 | Transcription factor, K-box |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. |
| UniProt | Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Acts as both an activator and a repressor of transcription. Binds DNA in a sequence-specific manner in large CArG motif 5'-CC (A/T)8 GG-3'. Participates probably in the regulation of programs active during the early stages of embryo development. Prevents premature perianth senescence and abscission, fruits development and seed desiccation. Stimulates the expression of at least DTA4, LEC2, FUS3, ABI3, AT4G38680/CSP2 and GRP2B/CSP4. Can enhance somatic embryo development in vitro. {ECO:0000269|PubMed:10318690, ECO:0000269|PubMed:10662856, ECO:0000269|PubMed:12226488, ECO:0000269|PubMed:12743119, ECO:0000269|PubMed:14615187, ECO:0000269|PubMed:15084721, ECO:0000269|PubMed:15686521, ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18305206, ECO:0000269|PubMed:19269998, ECO:0000269|PubMed:19767455, ECO:0000269|PubMed:8953767}. |