![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009616535.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 153aa MW: 16793.2 Da PI: 9.5765 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 78.5 | 1.8e-24 | 10 | 77 | 3 | 70 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70
+ +r+ ++h kv+g+dRRvRl+ +ca r+F L ++LG+++ + tieWLl qa+ +i ++ ++s+
XP_009616535.1 10 THSTRTRDRHLKVNGKDRRVRLPTSCAQRVFSLNEKLGHKTVGCTIEWLLMQAESSINAILAKKTSAL 77
5679*******************************************************999944443 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 6.8E-23 | 14 | 83 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 19.212 | 15 | 69 | IPR017887 | Transcription factor TCP subgroup |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MDVAPPPPPT HSTRTRDRHL KVNGKDRRVR LPTSCAQRVF SLNEKLGHKT VGCTIEWLLM 60 QAESSINAIL AKKTSALPSP LRLPPVVESS IPTSTHRNRS VLPPFVFCHG LELGAMEFSR 120 EEVERFASTT TSSESVGSSL ASQLMNASNE KIC |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved the regulation of plant development. Together with TCP15, modulates plant stature by promoting cell division in young internodes. Represses cell proliferation in leaf and floral tissues (PubMed:21668538). Together with TCP15, acts downstream of gibberellin (GA), and the stratification pathways that promote seed germination. Involved in the control of cell proliferation at the root apical meristem (RAM) by regulating the activity of CYCB1-1 (PubMed:25655823). Involved in the regulation of seed germination. May regulate the activation of embryonic growth potential during seed germination (PubMed:17953649, PubMed:22155632). Acts together with SPY to promote cytokinin responses that affect leaf shape and trichome development in flowers (PubMed:22267487). Transcription factor involved in the regulation of endoreduplication. Represses endoreduplication by activating the gene expression of the key cell-cycle regulators RBR1 and CYCA2-3 (PubMed:25757472). Regulates the expression of the defense gene pathogenesis-related protein 2 (PR2) in antagonism to SRFR1, a negative regulator of effector-triggered immunity (PubMed:24689742). Involved in positive regulation of plant defense. Represses jasmonate (JA) response to promote disease resistance. Regulates the plant immune system by transcriptionally repressing a subset of JA-responsive genes (PubMed:28132837). {ECO:0000269|PubMed:17953649, ECO:0000269|PubMed:21668538, ECO:0000269|PubMed:22155632, ECO:0000269|PubMed:22267487, ECO:0000269|PubMed:24689742, ECO:0000269|PubMed:25655823, ECO:0000269|PubMed:25757472, ECO:0000269|PubMed:28132837}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced during seed imbibition (PubMed:17953649). Circadian-regulation with the lowest expression in the middle of the dark period (PubMed:17953649). {ECO:0000269|PubMed:17953649}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009616535.1 | 1e-109 | PREDICTED: transcription factor TCP9-like | ||||
| Swissprot | Q93Z00 | 3e-18 | TCP14_ARATH; Transcription factor TCP14 | ||||
| TrEMBL | A0A1S3ZSW5 | 5e-93 | A0A1S3ZSW5_TOBAC; transcription factor TCP20-like | ||||
| STRING | XP_009616535.1 | 1e-108 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA15672 | 5 | 7 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69690.1 | 6e-19 | TCP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




