![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009617199.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 168aa MW: 18772.4 Da PI: 10.3777 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 101.2 | 1e-31 | 87 | 143 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RR++Rak+e ekkl +k rkpylheSRh+hAl+R+R+sgGrF
XP_009617199.1 87 QEPVFVNAKQYHGILRRRESRAKAELEKKL-IKVRKPYLHESRHQHALKRARASGGRF 143
69****************************.**************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 1.8E-34 | 85 | 146 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 36.027 | 86 | 146 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 6.1E-27 | 88 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 5.4E-23 | 89 | 111 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 91 | 111 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 5.4E-23 | 120 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 168 aa Download sequence Send to blast |
MRSHDGERSY PQVQNLQPVA STIPPKGDGS QTQPRQLELV THSIACAPNL YADPYYGGMM 60 TPFGQPMVPH VLDMHHLRMP LPHEMAQEPV FVNAKQYHGI LRRRESRAKA ELEKKLIKVR 120 KPYLHESRHQ HALKRARASG GRFAKKSNTD TSKGTCSGSG SNPDLSAL |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 1e-18 | 87 | 151 | 2 | 66 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC245977 | 2e-61 | AC245977.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone sle-58j6 map 1, complete sequence. | |||
| GenBank | AC246106 | 2e-61 | AC246106.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-9i12 map 1, complete sequence. | |||
| GenBank | AC246623 | 2e-61 | AC246623.5 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-36c24 map 1, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009617199.1 | 1e-123 | PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2 | ||||
| Swissprot | Q945M9 | 1e-45 | NFYA9_ARATH; Nuclear transcription factor Y subunit A-9 | ||||
| Swissprot | Q9LXV5 | 8e-46 | NFYA1_ARATH; Nuclear transcription factor Y subunit A-1 | ||||
| TrEMBL | A0A1S3XRI4 | 1e-118 | A0A1S3XRI4_TOBAC; nuclear transcription factor Y subunit A-1-like | ||||
| STRING | XP_009617196.1 | 1e-120 | (Nicotiana tomentosiformis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G12840.4 | 3e-48 | nuclear factor Y, subunit A1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




