PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009625923.1

Organism

Nicotiana tomentosiformis

Taxonomic ID

4098

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

WRKY

Protein Properties

Length: 146aa MW: 16655.6 Da PI: 9.4859

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009625923.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	108	4.7e-34	32	90	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYGqK+vkg+++prsYYrCt++gC+v+k+ver++ dpk+v++tYeg+Hnh+ XP_009625923.1 32 LDDGFKWRKYGQKVVKGNHHPRSYYRCTYPGCNVRKHVERASADPKAVITTYEGKHNHD 90 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	3.7E-37	18	92	IPR003657	WRKY domain
SuperFamily	SSF118290	1.7E-30	24	92	IPR003657	WRKY domain
PROSITE profile	PS50811	35.898	27	92	IPR003657	WRKY domain
SMART	SM00774	1.2E-39	32	91	IPR003657	WRKY domain
Pfam	PF03106	9.5E-27	33	90	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
CRKTAVEAPN LASSHKSESK IVVQTRSEVD ILDDGFKWRK YGQKVVKGNH HPRSYYRCTY 60 PGCNVRKHVE RASADPKAVI TTYEGKHNHD IPIARNRGHS TAQDSTRQLN EQDVATWRPS 120 LHENVAFHNT NEIPVCRQLK EEQIAA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	3e-40	23	92	8	77	Probable WRKY transcription factor 4
2lex_A	3e-40	23	92	8	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269\|PubMed:11449049, ECO:0000269\|PubMed:11722756}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB711135	0.0	AB711135.1 Nicotiana benthamiana NbWRKY14 mRNA for transcription factor, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009625923.1	1e-107	PREDICTED: probable WRKY transcription factor 58, partial
Swissprot	Q9ZQ70	7e-44	WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBL	A0A1S3ZC35	1e-98	A0A1S3ZC35_TOBAC; probable WRKY transcription factor 3
STRING	XP_009625923.1	1e-106	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA17453	3	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03340.1	3e-46	WRKY DNA-binding protein 3

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Aamir M, et al. Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach. Front Plant Sci, 2017. 8: p. 819 [PMID:28611792]