![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009628180.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 106aa MW: 11936.5 Da PI: 7.1895 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 164 | 2e-51 | 11 | 104 | 2 | 95 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+eqdr+lPianv+rimk++lP nakisk+aketvqecvsefi+fvt+eas+kc++e+rkt+ngdd++wal+tlGf+dy ++k +l++yre eg
XP_009628180.1 11 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETVQECVSEFIGFVTGEASEKCRKERRKTVNGDDVCWALGTLGFDDYGGAMKRFLHRYRENEG 104
89*****************************************************************************************987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.6E-47 | 4 | 103 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 3.88E-35 | 13 | 104 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.7E-26 | 16 | 80 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.7E-14 | 44 | 62 | No hit | No description |
| PRINTS | PR00615 | 1.7E-14 | 63 | 81 | No hit | No description |
| PRINTS | PR00615 | 1.7E-14 | 82 | 100 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MAQNDEGSNS KEQDRLLPIA NVGRIMKQIL PPNAKISKEA KETVQECVSE FIGFVTGEAS 60 EKCRKERRKT VNGDDVCWAL GTLGFDDYGG AMKRFLHRYR ENEGLN |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-42 | 11 | 101 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-42 | 11 | 101 | 2 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_016462866.1 | 3e-72 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
| Swissprot | O82248 | 1e-53 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A1S3ZF00 | 6e-71 | A0A1S3ZF00_TOBAC; nuclear transcription factor Y subunit B-5-like | ||||
| STRING | XP_009628180.1 | 2e-74 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 6e-56 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




