![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009760265.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 127aa MW: 14370 Da PI: 4.6164 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 150.2 | 4e-47 | 5 | 99 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
e+ +++Pianv+rimk++lP akisk+aket+qec+sefi+fvt+easdkc++e+r+t+ngdd++wal++lGf++y+e++ yl k re+e+++
XP_009760265.1 5 EHVKLVPIANVGRIMKQILPPTAKISKEAKETIQECASEFIGFVTGEASDKCHKENRRTVNGDDICWALSSLGFDNYAEAMLRYLYKLREFERQR 99
566899**************************************************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.8E-45 | 3 | 122 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.32E-35 | 10 | 120 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.0E-25 | 10 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 6.2E-16 | 37 | 55 | No hit | No description |
| PRINTS | PR00615 | 6.2E-16 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 6.2E-16 | 75 | 93 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 127 aa Download sequence Send to blast |
MEVDEHVKLV PIANVGRIMK QILPPTAKIS KEAKETIQEC ASEFIGFVTG EASDKCHKEN 60 RRTVNGDDIC WALSSLGFDN YAEAMLRYLY KLREFERQRA NQTKGSNDED TDHEAASESE 120 NQDITTT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 1e-36 | 3 | 94 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 1e-36 | 3 | 94 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975440 | 1e-89 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009760265.1 | 3e-92 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Refseq | XP_016458099.1 | 3e-92 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
| Swissprot | O04027 | 3e-53 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | A0A1S3Z0U4 | 7e-91 | A0A1S3Z0U4_TOBAC; nuclear transcription factor Y subunit B-4-like | ||||
| TrEMBL | A0A1U7VEK7 | 7e-91 | A0A1U7VEK7_NICSY; nuclear transcription factor Y subunit B-4-like | ||||
| STRING | XP_009760265.1 | 1e-91 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 1e-55 | nuclear factor Y, subunit B4 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




