![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009762097.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 136aa MW: 15048.8 Da PI: 9.9867 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 100.5 | 2.9e-31 | 67 | 130 | 2 | 65 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LG+d++ k +eWLl++a p+i el+++
XP_009762097.1 67 SGGKDRHSKVWTSKGLRDRRVRLSVNTAIQFYDLQDRLGYDQPNKDVEWLLKAAAPSISELPSL 130
689**********************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF03634 | 6.0E-31 | 68 | 130 | IPR005333 | Transcription factor, TCP |
| PROSITE profile | PS51369 | 30.865 | 69 | 127 | IPR017887 | Transcription factor TCP subgroup |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MEAWGKNLTN VTSLGETRTK KSCNGNGRFE SQDENETVKG SHGLGGGGVS RLCGWPSNWI 60 VRVSRASGGK DRHSKVWTSK GLRDRRVRLS VNTAIQFYDL QDRLGYDQPN KDVEWLLKAA 120 APSISELPSL NVFPDT |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 9e-24 | 74 | 128 | 1 | 55 | Putative transcription factor PCF6 |
| 5zkt_B | 9e-24 | 74 | 128 | 1 | 55 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009762097.1 | 9e-97 | PREDICTED: transcription factor TCP2-like | ||||
| Swissprot | Q93V43 | 4e-37 | TCP2_ARATH; Transcription factor TCP2 | ||||
| TrEMBL | A0A1U7V1H4 | 2e-95 | A0A1U7V1H4_NICSY; transcription factor TCP2-like | ||||
| STRING | XP_009762097.1 | 4e-96 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA2464 | 22 | 52 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18390.2 | 6e-39 | TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




