PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009763372.1

Organism

Nicotiana sylvestris

Taxonomic ID

4096

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

LBD

Protein Properties

Length: 84aa MW: 9533.41 Da PI: 10.1601

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009763372.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	66.1	8.5e-21	24	72	1	49
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkal 49 +Ca+Ck+lrr+Cakd ++apyfp ++p+kfa+vhk+FGasnv+k+l+ XP_009763372.1 24 PCASCKLLRRHCAKDGIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQVS 72 7*********************************************964 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	15.699	23	84	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	2.0E-19	24	71	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
YEKTALHFLL SLSLPKRKCI FISPCASCKL LRRHCAKDGI FAPYFPPDDP HKFAIVHKVF 60 GASNVSKMLQ VSRSSSHLLY ILLM

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	4e-18	23	70	10	57	LOB family transfactor Ramosa2.1
5ly0_B	4e-18	23	70	10	57	LOB family transfactor Ramosa2.1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975445	5e-45	HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBank	HG975518	5e-45	HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009763372.1	5e-55	PREDICTED: LOB domain-containing protein 12-like, partial
Swissprot	Q8LBW3	5e-27	LBD12_ARATH; LOB domain-containing protein 12
TrEMBL	A0A1U7V5B2	1e-53	A0A1U7V5B2_NICSY; LOB domain-containing protein 12-like
STRING	XP_009763372.1	2e-54	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA43	24	669

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30130.1	2e-29	LBD family protein

Publications ? help Back to Top
Penfield S, et al. Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1. Plant Cell, 2004. 16(10): p. 2705-18 [PMID:15367715]