PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_009773320.1

Organism

Nicotiana sylvestris

Taxonomic ID

4096

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

bHLH

Protein Properties

Length: 89aa MW: 10004.3 Da PI: 4.7008

Description

bHLH family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_009773320.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HLH	22.3	2.4e-07	14	54	14	54
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+iN+ +L++llP++s+ ++ iLe++++YI++L XP_009773320.1 14 DEINDLVLKLQSLLPNSSSHCTSRVPAPKILEETCNYIRML 54 78************86666667*************99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50888	11.02	1	54	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Gene3D	G3DSA:4.10.280.10	3.6E-7	13	70	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamily	SSF47459	3.57E-9	13	73	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain
Pfam	PF00010	1.8E-4	14	54	IPR011598	Myc-type, basic helix-loop-helix (bHLH) domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MSSSRRSSSR FSQDEINDLV LKLQSLLPNS SSHCTSRVPA PKILEETCNY IRMLHNEVDD 60 LSERLSQILA SVDTNTVDVL DTLISLLQQ

Functional Description ? help Back to Top
Source	Description
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.
UniProt	Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009773320.1	8e-57	PREDICTED: transcription factor ILI5-like
Swissprot	A2Z730	7e-20	ILI7_ORYSI; Transcription factor ILI7
Swissprot	Q338G6	7e-20	ILI7_ORYSJ; Transcription factor ILI7
TrEMBL	A0A1U7WGE9	2e-55	A0A1U7WGE9_NICSY; transcription factor ILI5-like
STRING	XP_009773320.1	3e-56	(Nicotiana sylvestris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA353	24	161

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74500.1	1e-21	activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992]