PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009779702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 77aa    MW: 9058.54 Da    PI: 10.7051
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009779702.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.12e-32959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien + rqvtfskRrngi+KKA+ELSvLCdaevaviifs++g+lye+ss
  XP_009779702.1  9 KRIENATSRQVTFSKRRNGIMKKAYELSVLCDAEVAVIIFSQKGRLYEFSS 59
                    79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.226161IPR002100Transcription factor, MADS-box
CDDcd002655.96E-38360No hitNo description
PRINTSPR004045.2E-32323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-30366IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.4E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MVRGKVQMKR IENATSRQVT FSKRRNGIMK KAYELSVLCD AEVAVIIFSQ KGRLYEFSSS  60
RYACFYFLNR FPHPRSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-19160160Myocyte-specific enhancer factor 2B
1tqe_Q8e-19160160Myocyte-specific enhancer factor 2B
1tqe_R8e-19160160Myocyte-specific enhancer factor 2B
1tqe_S8e-19160160Myocyte-specific enhancer factor 2B
6c9l_A8e-19160160Myocyte-specific enhancer factor 2B
6c9l_B8e-19160160Myocyte-specific enhancer factor 2B
6c9l_C8e-19160160Myocyte-specific enhancer factor 2B
6c9l_D8e-19160160Myocyte-specific enhancer factor 2B
6c9l_E8e-19160160Myocyte-specific enhancer factor 2B
6c9l_F8e-19160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3352403e-49AF335240.1 Petunia x hybrida MADS-box transcription factor FBP22 (FBP22) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009779702.11e-51PREDICTED: MADS-box protein SOC1-like, partial
SwissprotQ9FIS11e-31AGL42_ARATH; MADS-box protein AGL42
TrEMBLA0A1U7WID23e-50A0A1U7WID2_NICSY; MADS-box protein SOC1-like
STRINGXP_009779702.15e-51(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62165.45e-34AGAMOUS-like 42