![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_009803678.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 93aa MW: 10451.7 Da PI: 9.3987 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 29.6 | 1.3e-09 | 21 | 61 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+iN+ ++L++llP++ + +s K+s a +L+ +++YI+ L
XP_009803678.1 21 DQINDLVSKLQDLLPELRNRSSDKVSSARVLQDTCNYIRGL 61
79**************8799*******************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.280.10 | 9.1E-10 | 4 | 77 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| PROSITE profile | PS50888 | 11.325 | 7 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 4.5E-7 | 21 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 2.49E-10 | 21 | 79 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009742 | Biological Process | brassinosteroid mediated signaling pathway | ||||
| GO:0010086 | Biological Process | embryonic root morphogenesis | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MSSRRSSRSR HSGVSSRISE DQINDLVSKL QDLLPELRNR SSDKVSSARV LQDTCNYIRG 60 LHREVDDLSE RLSQLLATSD TAQAALIRSL LLQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor required for MONOPTEROS-dependent root initiation in embryo. Promotes the correct definition of the hypophysis cell division plane. Transcriptionally controlled by MONOPTEROS. Moves from its site of synthesis in pro-embryos cells into the hypophysis. Regulates brassinosteroid (BR) signaling by sequestering negative BR signaling components. May function as positive regulator of gibberellin signaling. May play a role in the regulation of light signaling and possibly auxin signaling. {ECO:0000269|PubMed:16527868, ECO:0000269|PubMed:20023194, ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:22339648}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Not induced by exogenous gibberellin. {ECO:0000269|PubMed:16527868}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009803678.1 | 1e-57 | PREDICTED: transcription factor PRE3-like | ||||
| Refseq | XP_016465220.1 | 1e-57 | PREDICTED: transcription factor PRE3-like | ||||
| Refseq | XP_019249022.1 | 1e-57 | PREDICTED: transcription factor PRE3-like | ||||
| Swissprot | Q9CA64 | 1e-37 | PRE3_ARATH; Transcription factor PRE3 | ||||
| TrEMBL | A0A1S3ZL01 | 3e-56 | A0A1S3ZL01_TOBAC; transcription factor PRE3-like | ||||
| TrEMBL | A0A1U7YKM5 | 3e-56 | A0A1U7YKM5_NICSY; transcription factor PRE3-like | ||||
| STRING | XP_009803678.1 | 5e-57 | (Nicotiana sylvestris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA353 | 24 | 161 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74500.1 | 2e-38 | activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




