![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010088441.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 69aa MW: 7076.74 Da PI: 4.8794 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 41.8 | 2.5e-13 | 3 | 35 | 65 | 97 |
NF-YB 65 ddllwalatlGfedyveplkvylkkyrelegek 97
dllwa+a+lGf+dyvepl+v+l+ yre e+e+
XP_010088441.1 3 VDLLWAMAKLGFDDYVEPLTVFLNGYRESETEH 35
59***************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.2E-8 | 3 | 37 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.51E-6 | 4 | 38 | IPR009072 | Histone-fold |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 69 aa Download sequence Send to blast |
MAVDLLWAMA KLGFDDYVEP LTVFLNGYRE SETEHTNPGR HEPFLRRGGS GSGGGGGGGG 60 GGSSSSSMA |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 51 | 62 | SGGGGGGGGGGS |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010088441.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010088443.1 | 2e-21 | nuclear transcription factor Y subunit B-3 | ||||
| TrEMBL | W9QFS5 | 3e-41 | W9QFS5_9ROSA; Nuclear transcription factor Y subunit B-9 | ||||
| STRING | XP_010088441.1 | 5e-42 | (Morus notabilis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G21970.1 | 2e-14 | NF-YB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 21401189 |




