![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010094804.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 184aa MW: 21455.8 Da PI: 9.0926 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 83.6 | 1.2e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKA ELS+LCdae+a+++fs tgkl+eyss
XP_010094804.1 9 KKIDNITARQVTFSKRRRGLFKKALELSTLCDAEIALLVFSATGKLFEYSS 59
68***********************************************96 PP
| |||||||
| 2 | K-box | 35.9 | 3.1e-13 | 88 | 143 | 14 | 69 |
K-box 14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
e+ ++ l+ Lk+e+e+ +e+R+++Ge+L++Lsl+e+++Le+ +e +l+++ + K
XP_010094804.1 88 LEHERNRLDSLKAELEEKTTELRRMKGEELQELSLEEIKELEKMVEAGLSRVAELK 143
578889999******************************************98877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 29.352 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.1E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.71E-31 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-26 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.88E-39 | 3 | 75 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 9.7E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-26 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.9E-26 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 8.571 | 88 | 184 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 4.8E-7 | 89 | 144 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 184 aa Download sequence Send to blast |
MTRQKIEIKK IDNITARQVT FSKRRRGLFK KALELSTLCD AEIALLVFSA TGKLFEYSSS 60 SMQQVIERYS FHSENPDKLV SQPSLDALEH ERNRLDSLKA ELEEKTTELR RMKGEELQEL 120 SLEEIKELEK MVEAGLSRVA ELKVCFLDQF DAPLAHFKLR KGYVFWFVQD QRVVKEINSL 180 KKKV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 8e-22 | 1 | 94 | 1 | 94 | MEF2C |
| 5f28_B | 8e-22 | 1 | 94 | 1 | 94 | MEF2C |
| 5f28_C | 8e-22 | 1 | 94 | 1 | 94 | MEF2C |
| 5f28_D | 8e-22 | 1 | 94 | 1 | 94 | MEF2C |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that mediates floral transition in response to vernalization. Promotes inflorescence fate in apical meristems. Acts in a dosage-dependent manner. Probably involved in the transduction of RLK-mediated signaling (e.g. IMK3 pathway). Together with AP1 and SVP, controls the identity of the floral meristem and regulates expression of class B, C and E genes. When associated with SOC1, mediates effect of gibberellins on flowering under short-day conditions, and regulates the expression of LEAFY (LFY), which links floral induction and floral development. Confers inflorescence characteristics to floral primordia and early flowering. {ECO:0000269|PubMed:12451184, ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:12881501, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18466303, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010094804.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by vernalization in a FLC-independent manner. Repressed by the floral homeotic genes AP1, LFY and SEP3 in emerging floral meristems to establish a floral identity and prevent inflorescence fate. Up-regulated at the shoot apex by SOC1. {ECO:0000269|PubMed:12609028, ECO:0000269|PubMed:14716314, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18339670, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024020325.1 | 2e-92 | MADS-box protein AGL24 isoform X1 | ||||
| Refseq | XP_024020326.1 | 1e-92 | MADS-box protein JOINTLESS isoform X2 | ||||
| Swissprot | O82794 | 6e-54 | AGL24_ARATH; MADS-box protein AGL24 | ||||
| TrEMBL | W9R5B4 | 1e-130 | W9R5B4_9ROSA; MADS-box protein AGL24 | ||||
| STRING | XP_010094804.1 | 1e-131 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF890 | 33 | 106 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G24540.1 | 5e-42 | AGAMOUS-like 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 21394638 |




