PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010095224.1

Organism

Morus notabilis

Taxonomic ID

981085

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus

Family

GRAS

Protein Properties

Length: 90aa MW: 9153.43 Da PI: 9.4622

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010095224.1	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	24.1	4e-08	39	81	1	43
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaa 43 lv++L++cAeav++++l+ a++l++++ la++++ ++++a XP_010095224.1 39 LVHTLMACAEAVQQDNLKFANTLVKHVGLLAASQAGGLRKVAM 81 689*************************************995 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03514	1.4E-5	39	81	IPR005202	Transcription factor GRAS

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:1903506	Biological Process	regulation of nucleic acid-templated transcription

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MTGAAVSIKS SSSSPLKTEV SESTRAVILF NSHDAGVRLV HTLMACAEAV QQDNLKFANT 60 LVKHVGLLAA SQAGGLRKVA MEAAGSGNSG

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Has overlapping but distinct roles in GA signaling compared to RGA and GAI. Regulates the floral development. May also participate in seed germination and in ovule and anther development. Its activity is probably regulated by other phytohormones such as auxin and ethylene. {ECO:0000269\|PubMed:11826301, ECO:0000269\|PubMed:11877383, ECO:0000269\|PubMed:12610625, ECO:0000269\|PubMed:14615596, ECO:0000269\|PubMed:14973286, ECO:0000269\|PubMed:15128937, ECO:0000269\|PubMed:16034591}.
UniProt	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010095224.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Not up-regulated upon GA treatment.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010109004.2	1e-35	DELLA protein GAI
Swissprot	Q84TQ7	7e-22	GAI_GOSHI; DELLA protein GAI
Swissprot	Q9C8Y3	7e-22	RGL1_ARATH; DELLA protein RGL1
TrEMBL	W9QYN9	4e-57	W9QYN9_9ROSA; Uncharacterized protein
STRING	XP_010095224.1	6e-58	(Morus notabilis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G66350.1	5e-23	RGA-like 1

Link Out ? help Back to Top
Entrez Gene	21386329

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Yan A, et al. AtEXP2 is involved in seed germination and abiotic stress response in Arabidopsis. PLoS ONE, 2014. 9(1): p. e85208 [PMID:24404203] Gallego-Giraldo C, et al. Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis. Plant J., 2014. 79(6): p. 1020-1032 [PMID:24961590] Fukazawa J, et al. DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis. Plant Cell, 2014. 26(7): p. 2920-38 [PMID:25035403] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Li W,Wang H,Yu D Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] Li Y,Wang H,Li X,Liang G,Yu D Two DELLA-interacting proteins bHLH48 and bHLH60 regulate flowering under long-day conditions in Arabidopsis thaliana. J. Exp. Bot., 2017. 68(11): p. 2757-2767 [PMID:28591805] Chen L,Xiang S,Chen Y,Li D,Yu D Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence. Mol Plant, 2017. 10(9): p. 1174-1189 [PMID:28735023] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]