![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010096858.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 125aa MW: 13976.9 Da PI: 4.0294 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 75.4 | 1e-23 | 48 | 106 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k++++++d++++ +isw ++g sfvv+d+ efa+ vLp+ Fkh+nf+SFvRQLn+Y
XP_010096858.1 48 FLSKTFDLVDDPAIDAIISWGSTGGSFVVWDPVEFARLVLPRNFKHNNFSSFVRQLNTY 106
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 2.9E-25 | 43 | 106 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 1.8E-20 | 44 | 125 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 5.44E-24 | 46 | 106 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 4.6E-13 | 48 | 71 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 2.7E-20 | 48 | 106 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.6E-13 | 86 | 98 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 4.6E-13 | 99 | 111 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MAELDPTLFM DAFPYSESPM FEFEAEENKP VVVPQPLECL QGNPIPPFLS KTFDLVDDPA 60 IDAIISWGST GGSFVVWDPV EFARLVLPRN FKHNNFSSFV RQLNTYVGIF SCYTALKCSG 120 FADVV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ldu_A | 5e-18 | 45 | 106 | 17 | 78 | Heat shock factor protein 1 |
| 5hdg_A | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_A | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_B | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_C | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| 5hdn_D | 4e-18 | 45 | 106 | 7 | 68 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010096858.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:17999647, ECO:0000269|PubMed:18261981}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010092004.2 | 6e-88 | heat stress transcription factor A-3 | ||||
| Refseq | XP_010096858.2 | 6e-88 | heat stress transcription factor A-3 | ||||
| Swissprot | Q8GYY1 | 6e-39 | HSFA3_ARATH; Heat stress transcription factor A-3 | ||||
| TrEMBL | W9T1P5 | 7e-87 | W9T1P5_9ROSA; Heat stress transcription factor A-3 | ||||
| STRING | XP_010092004.1 | 1e-87 | (Morus notabilis) | ||||
| STRING | XP_010096858.1 | 1e-87 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G03720.1 | 2e-41 | heat shock transcription factor A3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 21384165 | 21387099 |




