![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010097397.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10009.5 Da PI: 10.7792 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53.9 | 4e-17 | 32 | 79 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g WT+e+de l+ ++k++G g+W t +++ g+ R++k+c++rw +yl
XP_010097397.1 32 KGTWTPEDDEVLATYIKRHGEGHWGTLPEHAGLLRCGKSCRLRWVNYL 79
799*****************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 4.4E-21 | 24 | 87 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 20.183 | 27 | 83 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 6.06E-17 | 27 | 87 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 3.3E-12 | 31 | 81 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.9E-15 | 32 | 79 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.69E-10 | 34 | 79 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MIRNPSSFGH NYFSSSKQKS KTPCGRKVGI KKGTWTPEDD EVLATYIKRH GEGHWGTLPE 60 HAGLLRCGKS CRLRWVNYLR PSIKRGPI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that may play a role in flower development by repressing ANT (PubMed:19232308). Regulates the transition of meristem identity from vegetative growth to flowering. Acts downstream of LFY and upstream of AP1. Directly activates AP1 to promote floral fate. Together with LFY and AP1 may constitute a regulatory network that contributes to an abrupt and robust meristem identity transition (PubMed:21750030). {ECO:0000269|PubMed:19232308, ECO:0000269|PubMed:21750030}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010097397.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010097400.1 | 3e-47 | transcription repressor MYB5 | ||||
| Swissprot | Q9M2D9 | 7e-30 | MYB17_ARATH; Transcription factor MYB17 | ||||
| TrEMBL | W9RSX9 | 4e-59 | W9RSX9_9ROSA; Myb-related protein Myb4 | ||||
| STRING | XP_010097397.1 | 7e-60 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G61250.1 | 3e-32 | myb domain protein 17 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Entrez Gene | 21392271 |




