![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010527213.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
| Family | B3 | ||||||||
| Protein Properties | Length: 126aa MW: 14180.4 Da PI: 11.323 | ||||||||
| Description | B3 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | B3 | 53.4 | 4.8e-17 | 6 | 68 | 34 | 98 |
SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
B3 34 ktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
++l+ +d + sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +dg+s +l+++++
XP_010527213.1 6 QELVAKDIHESSWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKS--QLLLGIRH 68
48999*********************************************76644..45888875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM01019 | 0.0087 | 1 | 70 | IPR003340 | B3 DNA binding domain |
| PROSITE profile | PS50863 | 11.589 | 1 | 70 | IPR003340 | B3 DNA binding domain |
| Gene3D | G3DSA:2.40.330.10 | 3.0E-25 | 2 | 83 | IPR015300 | DNA-binding pseudobarrel domain |
| SuperFamily | SSF101936 | 1.83E-22 | 2 | 97 | IPR015300 | DNA-binding pseudobarrel domain |
| Pfam | PF02362 | 1.5E-14 | 6 | 68 | IPR003340 | B3 DNA binding domain |
| CDD | cd10017 | 1.81E-10 | 6 | 67 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 126 aa Download sequence Send to blast |
MQPPAQELVA KDIHESSWTF RHIYRGQPKR HLLTTGWSVF VSTKRLFAGD SVLFIRDGKS 60 QLLLGIRHAN RQQPALSSSV ISSDSMHIGI LAAAAHAATN NSPFTIFYNP RLFLHTFFKI 120 PKPPFP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4ldu_A | 1e-53 | 2 | 111 | 192 | 301 | Auxin response factor 5 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Auxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Act as a transcriptional activator of several tropic stimulus-induced (TSI) genes, including SAUR50. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Required for differential growth responses of aerial tissues. Involved in ethylene responses. Regulates lateral root formation through direct regulation of LBD16 and/or LBD29. Functionally redundant with ARF19. Mediates embryo axis formation and vascular tissues differentiation. Functionally redundant with ARF5. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:14973283, ECO:0000269|PubMed:16371470, ECO:0000269|PubMed:16461383, ECO:0000269|PubMed:17259263}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010527213.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010527213.1 | 9e-89 | PREDICTED: auxin response factor 7-like | ||||
| Swissprot | P93022 | 2e-53 | ARFG_ARATH; Auxin response factor 7 | ||||
| TrEMBL | A0A498KLI9 | 4e-58 | A0A498KLI9_MALDO; Auxin response factor | ||||
| STRING | XP_010527213.1 | 3e-88 | (Tarenaya hassleriana) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G20730.1 | 1e-54 | ARF family protein | ||||




