![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010530323.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 192aa MW: 22425.1 Da PI: 10.3206 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 97.8 | 4.6e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvt+skRrng++KKA+ELS+LCda+v+vi+fss++kl+ey s
XP_010530323.1 9 KRIENQTNRQVTYSKRRNGLFKKAHELSILCDARVSVIMFSSSNKLHEYTS 59
79***********************************************75 PP
| |||||||
| 2 | K-box | 56.5 | 1.2e-19 | 71 | 143 | 1 | 73 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnell 73
yqk+sg++ +++++e++q+ ++L + ++nL+++++++lGe+L++L++++L++Le+++e+ + +R+kK + l
XP_010530323.1 71 YQKASGVDIWASHYERMQEIKKQLLETNRNLRKQIKQRLGECLDELEINDLRRLEEEMENTTNLVRTKKFKSL 143
899******************************************************************9877 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.2E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 32.127 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 2.88E-37 | 2 | 94 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 6.44E-41 | 3 | 80 | No hit | No description |
| Pfam | PF00319 | 2.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.0E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.1E-9 | 82 | 143 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 9.272 | 84 | 186 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010093 | Biological Process | specification of floral organ identity | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 192 aa Download sequence Send to blast |
MTRGKIQIKR IENQTNRQVT YSKRRNGLFK KAHELSILCD ARVSVIMFSS SNKLHEYTSP 60 NTSTKEIIDM YQKASGVDIW ASHYERMQEI KKQLLETNRN LRKQIKQRLG ECLDELEIND 120 LRRLEEEMEN TTNLVRTKKF KSLLPLSFFS FFAFSAANLQ RECKVCMSIR QTNTVVKGVL 180 VIIKDIFIGN VV |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 1e-17 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 1e-17 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 1e-17 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 1e-17 | 3 | 61 | 2 | 60 | Myocyte-specific enhancer factor 2A |
| 6byy_A | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_B | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_C | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_D | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_A | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_B | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_C | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_D | 1e-17 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms a heterodimer with PISTILLATA that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP. AP3/PI prevents GATA22/GNL and GATA21/GNC expression (PubMed:18417639). {ECO:0000269|PubMed:18417639, ECO:0000269|PubMed:8565821, ECO:0000269|PubMed:9489703}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00077 | ChIP-seq | Transfer from AT3G54340 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010530323.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated by the meristem identity proteins APETALA1 and LEAFY with the cooperation of UFO. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. {ECO:0000269|PubMed:11283333, ECO:0000269|PubMed:19783648}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010530323.1 | 1e-140 | PREDICTED: floral homeotic protein APETALA 3-like isoform X2 | ||||
| Swissprot | P35632 | 3e-83 | AP3_ARATH; Floral homeotic protein APETALA 3 | ||||
| TrEMBL | A0A078JQI6 | 9e-82 | A0A078JQI6_BRANA; BnaAnng31650D protein | ||||
| TrEMBL | M4DEA1 | 3e-81 | M4DEA1_BRARP; Uncharacterized protein | ||||
| STRING | XP_010530322.1 | 2e-99 | (Tarenaya hassleriana) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G54340.1 | 1e-81 | MIKC_MADS family protein | ||||




