![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010536668.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 121aa MW: 12997.9 Da PI: 10.0271 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 55.9 | 9.5e-18 | 29 | 76 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+ Ede+l+ +v+++G g+W+++ + g+ R++k+c++rw ++l
XP_010536668.1 29 KGPWTAAEDEILAAYVREHGEGNWNAVQKNTGLARCGKSCRLRWANHL 76
79******************************************9996 PP
| |||||||
| 2 | Myb_DNA-binding | 27.3 | 8.6e-09 | 82 | 111 | 1 | 31 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31
+g++T+eE+ l++++++qlG++ W++ a+ +
XP_010536668.1 82 KGAFTAEEERLIIQLHAQLGNK-WARMAAQV 111
799*******************.***99865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.613 | 24 | 80 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 27 | 79 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.3E-13 | 28 | 78 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.2E-16 | 29 | 76 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.95E-25 | 30 | 106 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 2.39E-11 | 31 | 76 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 5.9E-14 | 80 | 112 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 9.358 | 81 | 121 | IPR017930 | Myb domain |
| SMART | SM00717 | 3.8 | 81 | 114 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-7 | 82 | 111 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 0.00325 | 84 | 111 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 121 aa Download sequence Send to blast |
MILYGGGASK EGGSASSDGG GGLAVVLKKG PWTAAEDEIL AAYVREHGEG NWNAVQKNTG 60 LARCGKSCRL RWANHLRPNL KKGAFTAEEE RLIIQLHAQL GNKWARMAAQ VTNPLLLLFI 120 T |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 7e-21 | 27 | 108 | 25 | 105 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB101 and MYB120, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. | |||||
| UniProt | Transcription activator (PubMed:24278028). Binds to 5'-CAACTGTC-3' and/or 5'-TAACAAA-3' motif in target gene promoter to promote their expression (By similarity). Together with MYB97 and MYB101, functions as a male factor that controls pollen tube-synergid interaction in fertilization. Required for pollen tube growth arrest and sperm cell release in the female gametophyte, probably via the regulation of pollen tube-specific gene expression (PubMed:24278028, PubMed:23791732). {ECO:0000250|UniProtKB:O80883, ECO:0000269|PubMed:23791732, ECO:0000269|PubMed:24278028}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010536668.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates in pollen tube 4 hours after pollen germination. {ECO:0000269|PubMed:19714218}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010536668.1 | 6e-84 | PREDICTED: transcription factor GAMYB-like | ||||
| Swissprot | Q94FL7 | 2e-57 | MY120_ARATH; Transcription factor MYB120 | ||||
| Swissprot | Q9S773 | 1e-58 | MYB97_ARATH; Transcription factor MYB97 | ||||
| TrEMBL | A0A3P6CGV9 | 2e-59 | A0A3P6CGV9_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4CFF6 | 2e-59 | M4CFF6_BRARP; Uncharacterized protein | ||||
| STRING | XP_010536668.1 | 2e-83 | (Tarenaya hassleriana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM4 | 28 | 2646 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G55020.1 | 7e-53 | myb domain protein 120 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




