![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010538582.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 245aa MW: 28467.1 Da PI: 10.0725 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 98.7 | 2.4e-31 | 34 | 84 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyeys+
XP_010538582.1 34 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSN 84
79***********************************************95 PP
| |||||||
| 2 | K-box | 97.1 | 2.8e-32 | 98 | 194 | 4 | 100 |
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
s++s +e +a ++qqe++kL++ i +q+++R+l+Ge ++s+ k+L+ Le++L++++++iRskKnell+++ie+++k+e +l ++n+ Lr+k+
XP_010538582.1 98 ISDNSXSEINAHYYQQEAQKLRQHILGIQNSNRQLMGETIGSMVPKDLRTLERKLDTAISRIRSKKNELLFAEIEHMRKREADLYNDNNLLRAKI 192
567779999*************************************************************************************9 PP
K-box 99 ee 100
+e
XP_010538582.1 193 AE 194
86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.9E-40 | 26 | 85 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.109 | 26 | 86 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.03E-44 | 27 | 100 | No hit | No description |
| SuperFamily | SSF55455 | 5.89E-33 | 27 | 99 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.2E-33 | 28 | 48 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 28 | 82 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.2E-26 | 35 | 82 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.2E-33 | 48 | 63 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.2E-33 | 63 | 84 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 6.7E-25 | 106 | 192 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 13.541 | 108 | 198 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 245 aa Download sequence Send to blast |
MLQFSYFATT AYQTELGSET SLQRKSGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL 60 SVLCDAEIAL IVFSSRGRLY EYSNNSVKAT IERYKKAISD NSXSEINAHY YQQEAQKLRQ 120 HILGIQNSNR QLMGETIGSM VPKDLRTLER KLDTAISRIR SKKNELLFAE IEHMRKREAD 180 LYNDNNLLRA KIAENERNHP SMMNLMPGRS NYEEQPMMPQ PSQQFDSRSY FQVAALQPNH 240 HFSGK |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1egw_A | 4e-20 | 27 | 94 | 1 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_B | 4e-20 | 27 | 94 | 1 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_C | 4e-20 | 27 | 94 | 1 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1egw_D | 4e-20 | 27 | 94 | 1 | 68 | MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A |
| 1tqe_P | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 3mu6_A | 4e-20 | 27 | 94 | 1 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 4e-20 | 27 | 94 | 1 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 4e-20 | 27 | 94 | 1 | 68 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 4e-20 | 27 | 94 | 1 | 68 | Myocyte-specific enhancer factor 2A |
| 6c9l_A | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-20 | 27 | 94 | 2 | 69 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269|PubMed:15254538, ECO:0000269|PubMed:19956801}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010538582.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269|PubMed:10198637, ECO:0000269|PubMed:11058164, ECO:0000269|PubMed:1675158, ECO:0000269|PubMed:17794879, ECO:0000269|PubMed:18281509, ECO:0000269|PubMed:19783648, ECO:0000269|PubMed:9783581}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010538582.1 | 0.0 | PREDICTED: LOW QUALITY PROTEIN: floral homeotic protein AGAMOUS-like | ||||
| Swissprot | P17839 | 1e-129 | AG_ARATH; Floral homeotic protein AGAMOUS | ||||
| TrEMBL | A0A1J3EYB8 | 1e-131 | A0A1J3EYB8_NOCCA; Floral homeotic protein AGAMOUS (Fragment) | ||||
| STRING | XP_010538582.1 | 0.0 | (Tarenaya hassleriana) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Malvids | OGEM6181 | 22 | 37 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G18960.1 | 1e-129 | MIKC_MADS family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




