PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010543715.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

MYB

Protein Properties

Length: 199aa MW: 22703 Da PI: 10.7227

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010543715.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.6	3.4e-19	18	63	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W +e d +lv++v+q+G+++W++I++ ++ gRt+k+c++rw + XP_010543715.1 18 KGPWRPEQDAQLVKLVHQYGPRNWSLISSLIP-GRTGKSCRLRWCNQ 63 79****************************.*********985 PP
2	Myb_DNA-binding	56.3	7.5e-18	72	113	3	46
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 + T eEd l+v+a++ +G++ W+tIar ++ gRt++ +k+rw++ XP_010543715.1 72 PYTLEEDNLIVQAHAIHGNK-WATIARLLP-GRTDNAVKNRWNS 113 679***************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	24.978	13	68	IPR017930	Myb domain
SuperFamily	SSF46689	3.73E-30	17	111	IPR009057	Homeodomain-like
SMART	SM00717	7.2E-16	17	66	IPR001005	SANT/Myb domain
Pfam	PF00249	9.6E-18	18	63	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.6E-25	19	71	IPR009057	Homeodomain-like
CDD	cd00167	3.78E-14	20	62	No hit	No description
SMART	SM00717	2.0E-14	69	117	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	18.799	69	119	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.9E-22	72	118	IPR009057	Homeodomain-like
Pfam	PF00249	2.7E-15	72	113	IPR001005	SANT/Myb domain
CDD	cd00167	5.70E-12	72	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 199 aa Download sequence Send to blast
MRMRKKREGE ERKKAGVKGP WRPEQDAQLV KLVHQYGPRN WSLISSLIPG RTGKSCRLRW 60 CNQLRPEVHH RPYTLEEDNL IVQAHAIHGN KWATIARLLP GRTDNAVKNR WNSALQRRPH 120 LDPAKGFNPF GATQNKRQRL DSSNNGDSVA GKPAEANAMQ PKAEEERKCM MQILQQMIAQ 180 EVKSYIDGLV SEAKDNLAI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	7e-38	17	118	3	104	MYB PROTO-ONCOGENE PROTEIN
1mse_C	8e-38	17	118	3	104	C-Myb DNA-Binding Domain
1msf_C	8e-38	17	118	3	104	C-Myb DNA-Binding Domain
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	1	13	RMRKKREGEERKK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202, ECO:0000269\|PubMed:23603962, ECO:0000269\|PubMed:24894996, ECO:0000269\|PubMed:9678577}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010543715.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18162593, ECO:0000269\|PubMed:23067202}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010543715.1	1e-148	PREDICTED: transcription factor MYB44-like
Swissprot	Q9FDW1	8e-49	MYB44_ARATH; Transcription factor MYB44
TrEMBL	M5XTD9	1e-57	M5XTD9_PRUPE; Uncharacterized protein
STRING	XP_010543715.1	1e-147	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM677	28	135

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G67300.1	3e-49	myb domain protein r1

Publications ? help Back to Top
Li C,Chang PP,Ghebremariam KM,Qin L,Liang Y Overexpression of tomato SpMPK3 gene in Arabidopsis enhances the osmotic tolerance. Biochem. Biophys. Res. Commun., 2014. 443(2): p. 357-62 [PMID:24275141] Jaradat MR,Feurtado JA,Huang D,Lu Y,Cutler AJ Multiple roles of the transcription factor AtMYBR1/AtMYB44 in ABA signaling, stress responses, and leaf senescence. BMC Plant Biol., 2013. 13: p. 192 [PMID:24286353] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Li D, et al. Arabidopsis ABA receptor RCAR1/PYL9 interacts with an R2R3-type MYB transcription factor, AtMYB44. Int J Mol Sci, 2014. 15(5): p. 8473-90 [PMID:24828206] Xu DB, et al. A G-protein β subunit, AGB1, negatively regulates the ABA response and drought tolerance by down-regulating AtMPK6-related pathway in Arabidopsis. PLoS ONE, 2015. 10(1): p. e0116385 [PMID:25635681] Hieno A, et al. Possible Involvement of MYB44-Mediated Stomatal Regulation in Systemic Resistance Induced by Penicillium simplicissimum GP17-2 in Arabidopsis. Microbes Environ., 2016. 31(2): p. 154-9 [PMID:27301421] Zhao Q, et al. AtMYB44 Positively Regulates the Enhanced Elongation of Primary Roots Induced by N-3-Oxo-Hexanoyl-Homoserine Lactone in Arabidopsis thaliana. Mol. Plant Microbe Interact., 2016. 29(10): p. 774-785 [PMID:27604593] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Nguyen NH,Cheong JJ H2A.Z-containing nucleosomes are evicted to activate AtMYB44 transcription in response to salt stress. Biochem. Biophys. Res. Commun., 2018. 499(4): p. 1039-1043 [PMID:29649476] Nguyen NH,Cheong JJ AtMYB44 interacts with TOPLESS-RELATED corepressors to suppress protein phosphatase 2C gene transcription. Biochem. Biophys. Res. Commun., 2018. 507(1-4): p. 437-442 [PMID:30448055]