PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010550056.1

Organism

Tarenaya hassleriana

Taxonomic ID

28532

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya

Family

ZF-HD

Protein Properties

Length: 101aa MW: 11081.4 Da PI: 5.4594

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010550056.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	34.4	5.2e-11	3	36	23	57
ZF-HD_dimer 23 DGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 D C+ f+p geegt+++l C+ CgCH +FH + v XP_010550056.1 3 DFCKHFVPG-GEEGTPESLLCSGCGCHLSFHEKIV 36 78****9.999****************9875 PP
2	ZF-HD_dimer	82.2	6e-26	47	99	3	56
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 ++rY eC+kNh ++G +++DGCgEfm++ ge+g+++++ CaACgCHR+FH re XP_010550056.1 47 SFRYGECKKNHGMDTGDYVLDGCGEFMAA-GEDGSPESFSCAACGCHRSFHHRE 99 689***********************9.999****************998 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51523	11.937	1	35	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	1.0E-4	3	39	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.0E-10	3	34	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	7.0E-14	46	99	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	9.3E-25	48	99	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	3.7E-23	49	99	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	22.463	50	99	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MRDFCKHFVP GGEEGTPESL LCSGCGCHLS FHEKIVATLK MDVASESFRY GECKKNHGMD 60 TGDYVLDGCG EFMAAGEDGS PESFSCAACG CHRSFHHREY F

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_010550056.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010550056.1	9e-69	PREDICTED: mini zinc finger protein 3-like
Swissprot	Q9LJW5	1e-17	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A1J3CY77	1e-31	A0A1J3CY77_NOCCA; Mini zinc finger protein 1
STRING	XP_010550056.1	3e-68	(Tarenaya hassleriana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17489	7	8

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	5e-20	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]