![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | XP_010551470.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 139aa MW: 15871 Da PI: 9.2495 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 47.9 | 3.2e-15 | 4 | 49 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++WT+eE+ +++++ +lG+g+W++I+r +Rt+ q+ s+ qky
XP_010551470.1 4 NPWTEEEHMRFLRGLDELGKGDWRAISRNYVVTRTPTQVASHAQKY 49
69*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 18.625 | 1 | 54 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.1E-10 | 2 | 52 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 1.05E-15 | 4 | 54 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 4.8E-13 | 4 | 49 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.7E-11 | 4 | 48 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.5E-17 | 5 | 52 | IPR006447 | Myb domain, plants |
| CDD | cd00167 | 8.23E-11 | 5 | 50 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 139 aa Download sequence Send to blast |
MRGNPWTEEE HMRFLRGLDE LGKGDWRAIS RNYVVTRTPT QVASHAQKYF LRLNCLNNRR 60 RRGSSLFDIT IDSVTISRQE KPMVFPVIGE SSQTPIRMFQ PPVLRISDLS LNDRPPELFL 120 SLAMPSSPSS SDEPNPVDA |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}. | |||||
| UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | XP_010551470.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010551470.1 | 8e-99 | PREDICTED: transcription factor MYB1R1 isoform X2 | ||||
| Swissprot | B8A9B2 | 3e-29 | MYBS1_ORYSI; Transcription factor MYBS1 | ||||
| Swissprot | Q8LH59 | 3e-29 | MYBS1_ORYSJ; Transcription factor MYBS1 | ||||
| TrEMBL | V7CAD3 | 4e-32 | V7CAD3_PHAVU; Uncharacterized protein | ||||
| STRING | XP_010551469.1 | 2e-90 | (Tarenaya hassleriana) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G70000.2 | 1e-27 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




