| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 47.1 | 3e-15 | 1 | 31 | 21 | 51 |
HHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 21 lKKAeELSvLCdaevaviifsstgklyeyss 51
+KKA+EL vLCdaev++i+fsstgk+ ey+s
XP_010906391.1 1 MKKAKELTVLCDAEVSLIMFSSTGKFSEYCS 31
8****************************96 PP
|
| 2 | K-box | 90.9 | 2.3e-30 | 43 | 141 | 1 | 99 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95
yq+ sg +l++a++e++q+ l+ L++ ++nL+re+R+++GedL+sL + eL+ Leq+L+++lk +R +K++++++q+++ +kk k+ +e++k+L
XP_010906391.1 43 YQQVSGINLWSAQYEKMQNTLNHLREINQNLRREIRQRMGEDLDSLGIHELRGLEQNLDEALKVVRHRKYHVITTQTDTYKKKLKNSNEAHKNLL 137
7899999***************************************************************************************9 PP
K-box 96 kkle 99
++le
XP_010906391.1 138 HELE 141
9986 PP
|
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Chen ZX, et al.
Morphogenesis and molecular basis on naked seed rice, a novel homeotic mutation of OsMADS1 regulating transcript level of AP3 homologue in rice. Planta, 2006. 223(5): p. 882-90 [PMID:16254725] - Adam H, et al.
MADS box genes in oil palm (Elaeis guineensis): patterns in the evolution of the SQUAMOSA, DEFICIENS, GLOBOSA, AGAMOUS, and SEPALLATA subfamilies. J. Mol. Evol., 2006. 62(1): p. 15-31 [PMID:16320117] - Zhang Q, et al.
Morphological, anatomical and genetic analysis for a rice mutant with abnormal hull. J Genet Genomics, 2007. 34(6): p. 519-26 [PMID:17601611] - Yoshida H, et al.
superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice. Plant Biotechnol. J., 2007. 5(6): p. 835-46 [PMID:17764519] - Yao SG,Ohmori S,Kimizu M,Yoshida H
Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development. Plant Cell Physiol., 2008. 49(5): p. 853-7 [PMID:18378529] - Xiao H, et al.
STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice. Plant J., 2009. 59(5): p. 789-801 [PMID:19453444] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] - Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] - Ohmori S,Tabuchi H,Yatou O,Yoshida H
Agronomic traits and gene containment capability of cleistogamous rice lines with the superwoman1-cleistogamy mutation. Breed. Sci., 2012. 62(2): p. 124-32 [PMID:23136523] - Yun D, et al.
OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] - Jaligot E, et al.
DNA methylation and expression of the EgDEF1 gene and neighboring retrotransposons in mantled somaclonal variants of oil palm. PLoS ONE, 2014. 9(3): p. e91896 [PMID:24638102] - Lombardo F, et al.
The superwoman1-cleistogamy2 mutant is a novel resource for gene containment in rice. Plant Biotechnol. J., 2017. 15(1): p. 97-106 [PMID:27336225]
|