PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010912706.1

Organism

Elaeis guineensis

Taxonomic ID

51953

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis

Family

MIKC_MADS

Protein Properties

Length: 234aa MW: 26871.4 Da PI: 9.2179

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010912706.1	genome	OG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.8	2.2e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fss+g+lyeys+ XP_010912706.1 9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYSN 59 79***********************************************95 PP
2	K-box	109.8	2.9e-36	79	174	5	100
K-box 5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 sg+ ++ ++++qqe+akL+ +i+ Lq+ +Rhl+G++L+sL++keL+qLe++Le+++++iRskK+ell+++ie++qk+e elq++n+ Lr+k++ XP_010912706.1 79 SGSIVDVDSQQYYQQESAKLRHQIQILQNANRHLMGDSLGSLTVKELKQLENRLERGITRIRSKKHELLFAEIEYMQKRELELQNANMHLRAKIA 173 4444777889***********************************************************************************98 PP K-box 100 e 100 e XP_010912706.1 174 E 174 6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.0E-42	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	33.978	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.64E-45	2	75	No hit	No description
SuperFamily	SSF55455	7.33E-33	2	74	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.0E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.4E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	4.0E-28	85	172	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.715	88	178	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFSS RGRLYEYSNN 60 SIKSTIERYK KACANTSNSG SIVDVDSQQY YQQESAKLRH QIQILQNANR HLMGDSLGSL 120 TVKELKQLEN RLERGITRIR SKKHELLFAE IEYMQKRELE LQNANMHLRA KIAETERAQQ 180 VSIIEAGHEF DALPGFDSRN YYHVSMLEAA PHYSHQQDQT ALHLGYEAKA DPAA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010912706.1	1e-174	MADS-box transcription factor 21
Refseq	XP_010912707.1	1e-174	MADS-box transcription factor 21
Swissprot	F6I457	1e-116	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	A0A2H3XCY8	1e-161	A0A2H3XCY8_PHODC; MADS-box transcription factor 3-like
STRING	XP_008781978.1	1e-162	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP649	37	144

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-106	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]