| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 57.7 | 2.7e-18 | 40 | 87 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT Ed +lvd+vk++G g+W+++ ++ g+ R++k+c++rw ++l
XP_010922971.1 40 KGPWTSAEDAILVDYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 87
79******************************************9986 PP
|
| 2 | Myb_DNA-binding | 51.4 | 2.4e-16 | 93 | 136 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+g++T+eE++l++++++++G++ W++ a+ ++ gRt++++k++w++
XP_010922971.1 93 KGAFTPEEEQLIIELHARMGNK-WARMAAQLP-GRTDNEIKNYWNT 136
799*******************.*********.***********96 PP
|
| Publications
? help Back to Top |
- Gocal GF, et al.
Long-day up-regulation of a GAMYB gene during Lolium temulentum inflorescence formation. Plant Physiol., 1999. 119(4): p. 1271-8 [PMID:10198085] - Ueguchi-Tanaka M, et al.
Rice dwarf mutant d1, which is defective in the alpha subunit of the heterotrimeric G protein, affects gibberellin signal transduction. Proc. Natl. Acad. Sci. U.S.A., 2000. 97(21): p. 11638-43 [PMID:11027362] - Sutoh K,Yamauchi D
Two cis-acting elements necessary and sufficient for gibberellin-upregulated proteinase expression in rice seeds. Plant J., 2003. 34(5): p. 635-45 [PMID:12787245] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Washio K
Functional dissections between GAMYB and Dof transcription factors suggest a role for protein-protein associations in the gibberellin-mediated expression of the RAmy1A gene in the rice aleurone. Plant Physiol., 2003. 133(2): p. 850-63 [PMID:14500792] - Eastmond PJ,Jones RL
Hormonal regulation of gluconeogenesis in cereal aleurone is strongly cultivar-dependent and gibberellin action involves SLENDER1 but not GAMYB. Plant J., 2005. 44(3): p. 483-93 [PMID:16236157] - Xie Z, et al.
Interactions of two abscisic-acid induced WRKY genes in repressing gibberellin signaling in aleurone cells. Plant J., 2006. 46(2): p. 231-42 [PMID:16623886] - Tsuji H, et al.
GAMYB controls different sets of genes and is differentially regulated by microRNA in aleurone cells and anthers. Plant J., 2006. 47(3): p. 427-44 [PMID:16792694] - Wang Y,Wang YF,Zhang DB
[Identification of the rice (Oryza sativa L.) mutant msp1-4 and expression analysis of its UDT1 and GAMYB genes]. Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2006. 32(5): p. 527-34 [PMID:17075175] - Liu SM,Wang ZY,Cai XL
[Preliminary screening of target genes of rice transcription factor OsBP-73]. Zhi Wu Sheng Li Yu Fen Zi Sheng Wu Xue Xue Bao, 2007. 33(5): p. 456-62 [PMID:17960050] - Aya K, et al.
Gibberellin modulates anther development in rice via the transcriptional regulation of GAMYB. Plant Cell, 2009. 21(5): p. 1453-72 [PMID:19454733] - Hu L,Tan H,Liang W,Zhang D
The Post-meiotic Deficicent Anther1 (PDA1) gene is required for post-meiotic anther development in rice. J Genet Genomics, 2010. 37(1): p. 37-46 [PMID:20171576] - Liu Z,Bao W,Liang W,Yin J,Zhang D
Identification of gamyb-4 and analysis of the regulatory role of GAMYB in rice anther development. J Integr Plant Biol, 2010. 52(7): p. 670-8 [PMID:20590996] - Plackett AR,Thomas SG,Wilson ZA,Hedden P
Gibberellin control of stamen development: a fertile field. Trends Plant Sci., 2011. 16(10): p. 568-78 [PMID:21824801] - Aya K, et al.
The Gibberellin perception system evolved to regulate a pre-existing GAMYB-mediated system during land plant evolution. Nat Commun, 2011. 2: p. 544 [PMID:22109518] - Hong YF, et al.
Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals. Plant Cell, 2012. 24(7): p. 2857-73 [PMID:22773748] - Wang Y, et al.
TamiR159 directed wheat TaGAMYB cleavage and its involvement in anther development and heat response. PLoS ONE, 2012. 7(11): p. e48445 [PMID:23133634] - Zhang Y, et al.
GmGBP1, a homolog of human ski interacting protein in soybean, regulates flowering and stress tolerance in Arabidopsis. BMC Plant Biol., 2013. 13: p. 21 [PMID:23388059] - Zhang Y, et al.
A GAMYB homologue CsGAMYB1 regulates sex expression of cucumber via an ethylene-independent pathway. J. Exp. Bot., 2014. 65(12): p. 3201-13 [PMID:24790111] - Yano K, et al.
Comprehensive gene expression analysis of rice aleurone cells: probing the existence of an alternative gibberellin receptor. Plant Physiol., 2015. 167(2): p. 531-44 [PMID:25511432] - Sutoh K, et al.
An N-terminal region of a Myb-like protein is involved in its intracellular localization and activation of a gibberellin-inducible proteinase gene in germinated rice seeds. Biosci. Biotechnol. Biochem., 2015. 79(5): p. 747-59 [PMID:25559339] - Kwon CT,Kim SH,Kim D,Paek NC
The Rice Floral Repressor Early flowering1 Affects Spikelet Fertility By Modulating Gibberellin Signaling. Rice (N Y), 2015. 8(1): p. 58 [PMID:26202549] - Suzuki A, et al.
Cloning and expression of five myb-related genes from rice seed. Gene, 1997. 198(1-2): p. 393-8 [PMID:9370307]
|