PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010931461.1

Organism

Elaeis guineensis

Taxonomic ID

51953

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis

Family

ZF-HD

Protein Properties

Length: 91aa MW: 9958.09 Da PI: 8.29

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010931461.1	genome	OG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	105.1	4.4e-33	21	78	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 + vrY+eC+kNhAas+Gg+avDGC+Efm+s geegt++al+CaAC+CHR+FH+reve+e XP_010931461.1 21 KVVRYRECRKNHAASIGGYAVDGCREFMAS-GEEGTSDALRCAACNCHRSFHKREVETE 78 579************************9.999*******************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	4.0E-24	21	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	8.9E-31	23	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.5E-27	24	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.311	25	74	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MGPQQDPKKP SSNGSVATKE KVVRYRECRK NHAASIGGYA VDGCREFMAS GEEGTSDALR 60 CAACNCHRSF HKREVETETV CDCSSISTSR R

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010931461.2	8e-58	mini zinc finger protein 2
Swissprot	Q9LJW5	2e-31	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A2H3ZY53	2e-46	A0A2H3ZY53_PHODC; mini zinc finger protein 1-like
STRING	XP_008792497.1	6e-52	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	1e-33	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]