PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_010932751.1

Organism

Elaeis guineensis

Taxonomic ID

51953

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis

Family

WRKY

Protein Properties

Length: 116aa MW: 13515.1 Da PI: 10.2863

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_010932751.1	genome	OG	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	70.8	1.8e-22	25	82	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+W+KYGqK +++ + r+Y++C ++C++kk+ve +dp+ +i+Y+g Hnh+ XP_010932751.1 25 EDGYEWKKYGQKFIQNIRKYRNYFKCRNKRCNAKKRVEWHPRDPSSKKIIYTGVHNHP 82 7********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	2.1E-24	15	84	IPR003657	WRKY domain
PROSITE profile	PS50811	20.507	19	84	IPR003657	WRKY domain
SuperFamily	SSF118290	1.22E-22	21	84	IPR003657	WRKY domain
SMART	SM00774	2.1E-22	24	83	IPR003657	WRKY domain
Pfam	PF03106	4.8E-19	25	82	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MASDPPPTNL EREDVREGRS LTLPEDGYEW KKYGQKFIQN IRKYRNYFKC RNKRCNAKKR 60 VEWHPRDPSS KKIIYTGVHN HPPPRPQSPS EQEASARVAN RYNLANQVLG SSSETS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010932751.1	2e-82	probable WRKY transcription factor 43
Swissprot	Q8VWJ2	8e-14	WRK28_ARATH; WRKY transcription factor 28
Swissprot	Q93WV4	7e-14	WRK71_ARATH; WRKY transcription factor 71
TrEMBL	A0A3Q0IMI8	8e-57	A0A3Q0IMI8_PHODC; WRKY transcription factor 71-like
STRING	GSMUA_Achr3P30880_001	3e-35	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP10158	34	44

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G64000.1	2e-08	WRKY DNA-binding protein 56

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu Y, et al. WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana. Plant J., 2016. 85(1): p. 96-106 [PMID:26643131] Guo D,Qin G EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses. Plant Signal Behav, 2016. 11(3): p. e1150404 [PMID:26914912] Yu Y, et al. WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana. Plant Cell Physiol., 2018. 59(2): p. 414-422 [PMID:29272465] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]